ESTScan Details for Unigene SGN-U220151

Score 
848
Direction 
Forward
Predicted Peptide Sequence 
GIGCRRVHPFSIYNNNKKKNPANPLITSFSXSSTILRWATMATSGVAASPIKYCLQLPVQCPGLREKRVSVSNLGRSSHCTVSTQKYHPR
RMPLVKCAMEASFGGSTDDSAAIFPRINVKDPYKRLGINIEASEDEIQAARNFLIQRYAGHKPSVDAIEAAHDKIIMQKFYDRKNPKIDV
KKKVREMKQSRVVQAVTSRFRTPATKFIVKTSIAFIVLGALTVLFPTEEGPTLQVAISLITAMYFIHDRLKNKLRAFLYGAGAFIXFLAS
GDILDGVCGSSHIQRAKEFGGDNFIDYVCTSVGVFYISHINRFHHLNFVREXAMIVGCNRMYC
Predicted Coding Sequence 
XXAGGAATTGGCTGCCGTAGAGTTCACCCTTTCTCAATCTACAATAACAACAAGAAGAAGAACCCAGCAAACCCTTTAATCACCAGTTTC
TCAGXTTCGTCAACTATACTAAGGTGGGCTACAATGGCAACATCAGGAGTAGCTGCTAGTCCCATAAAATACTGTCTCCAATTACCTGTA
CAATGTCCAGGGTTGCGTGAGAAGAGAGTTTCAGTTTCTAACTTAGGGAGATCAAGTCATTGTACTGTTTCTACACAGAAGTATCACCCA
AGAAGAATGCCTTTAGTGAAGTGTGCAATGGAAGCTTCTTTTGGTGGTTCTACAGATGACTCTGCTGCTATCTTTCCGAGAATTAATGTG
AAGGACCCATACAAACGACTTGGAATCAATATAGAAGCTTCCGAGGATGAAATCCAAGCTGCTAGGAACTTCCTAATACAAAGATATGCT
GGTCATAAACCAAGTGTGGATGCAATTGAAGCTGCCCATGATAAAATAATAATGCAGAAATTCTATGATAGAAAGAACCCAAAAATTGAC
GTTAAAAAGAAAGTCAGGGAAATGAAGCAATCTCGTGTTGTGCAGGCTGTTACTAGCAGGTTTAGGACACCAGCTACAAAGTTCATTGTG
AAAACTTCCATTGCTTTCATAGTCCTTGGAGCTCTCACAGTTCTGTTTCCTACTGAAGAAGGTCCAACCCTTCAAGTTGCCATTTCCCTG
ATCACTGCCATGTATTTCATTCATGATCGGTTAAAGAACAAACTTCGAGCTTTTCTATATGGAGCTGGTGCTTTTATTXTTTTCTTGGCT
TCTGGGGACATTCTTGATGGTGTCTGTGGTTCCTCCCATATTCAAAGGGCCAAGGAGTTTGGAGGTGACAACTTCATTGATTACGTATGT
ACTTCTGTGGGTGTCTTCTACATATCTCATATAAATCGGTTTCACCATCTCAATTTTGTTAGAGAAGXTGCCATGATTGTTGGTTGTAAC
CGCATGTATTGCTAA\
Edits in Original Sequence 
(5')XXAGGAATTGGCTGCCGTAGAGTTCACCCTTTCTCAATCTACAATAACAACAAGAAGAAGAACCCAGCAAACCCTTTAATCACCAG
TTTCTCAGXTTCGTCAACTATACTAAGGTGGGCTACAATGGCAACATCAGGAGTAGCTGCTAGTCCCATAAAATACTGTCTCCAATTACC
TGTACAATGTCCAGGGTTGCGTGAGAAGAGAGTTTCAGTTTCTAACTTAGGGAGATCAAGTCATTGTACTGTTTCTACACAGAAGTATCA
CCCAAGAAGAATGCCTTTAGTGAAGTGTGCAATGGAAGCTTCTTTTGGTGGTTCTACAGATGACTCTGCTGCTATCTTTCCGAGAATTAA
TGTGAAGGACCCATACAAACGACTTGGAATCAATATAGAAGCTTCCGAGGATGAAATCCAAGCTGCTAGGAACTTCCTAATACAAAGATA
TGCTGGTCATAAACCAAGTGTGGATGCAATTGAAGCTGCCCATGATAAAATAATAATGCAGAAATTCTATGATAGAAAGAACCCAAAAAT
TGACGTTAAAAAGAAAGTCAGGGAAATGAAGCAATCTCGTGTTGTGCAGGCTGTTACTAGCAGGTTTAGGACACCAGCTACAAAGTTCAT
TGTGAAAACTTCCATTGCTTTCATAGTCCTTGGAGCTCTCACAGTTCTGTTTCCTACTGAAGAAGGTCCAACCCTTCAAGTTGCCATTTC
CCTGATCACTGCCATGTATTTCATTCATGATCGGTTAAAGAACAAACTTCGAGCTTTTCTATATGGAGCTGGTGCTTTTATTXTTTTCTT
GGCTTCTGGGGACATTCTTGATGGTGTCTGTGGTTCCTCCCATATTCAAAGGGCCAAGGAGTTTGGAGGTGACAACTTCATTGATTACGT
ATGTACTTCTGTGGGTGTCTTCTACATATCTCATATAAATCGGTTTCACCATCTCAATTTTGTTAGAGAAGXTGCCATGATTGTTGGTTG
TAACCGCATGTATTGCTAA\(3')GATCTAGTGAGATTTTTGATTCAAGAAACTGTAGATTTATGAAATGAAACGCTTCTTCTTTGCTTA
GAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan