ESTScan Details for Unigene SGN-U220188

Score 
456
Direction 
Forward
Predicted Peptide Sequence 
MAMLQLYFIAYAGGLXSSLNKEALHLSNLSESSKLKLPDASLLLNSPTMPGHLGLNTDHSSRVAAAMAENATRKRDINVSASTYPRSKIP
KGTLPNMKNVPETGGGLXAPTSTYRKEQYCYRRHQQAISEEDLVLVAHREENEVTVDLTVV
Predicted Coding Sequence 
ATGGCCATGCTTCAATTATATTTTATTGCATATGCAGGAGGACTAGXTTCATCATTGAATAAAGAAGCATTACACTTGTCAAATTTATCG
GAGTCCTCTAAACTGAAACTCCCTGATGCATCACTTCTATTAAATTCACCTACAATGCCAGGCCATCTTGGACTCAATACTGACCATTCT
TCCCGAGTTGCAGCAGCCATGGCTGAAAATGCAACAAGGAAGCGGGATATAAATGTATCAGCATCCACTTATCCACGCAGTAAGATTCCT
AAAGGAACTTTGCCTAACATGAAGAATGTCCCTGAAACAGGAGGTGGTCTTXTTGCTCCCACCTCAACTTACCGGAAGGAGCAATATTGT
TACAGAAGACATCAGCAAGCTATTTCGGAAGAAGACCTCGTCTTAGTTGCACACAGAGAAGAGAATGAAGTCACTGTTGACCTAACTGTA
GTTTAA\
Edits in Original Sequence 
TCCCATATTCCTGCATTTTCTAGAATAAAGCGAATCTGAGTATTGTCCCACATAGCACAAAATTTCTATAGAAGGTGGAGAGATTATGGG
ACAGGGACGACTGGTATAAGTTTGCTAGCAGGGGATTTGTTAGTTTAGTGGAATTTGGAGTTTGGACACCCAAGAGCACTTCGAAGGTAA
TAGTGAAGTGTAGATTATGTGTTAAAAAGAATGACTTCTGTTGGCTGAGAATATCCCAAGCGAATACTGGAGACTGGTCAATGCAGTAGT
GTGCTATAAAGCTGTTGACTTGTATGTGCTTGGACTATTCAATCATTAATAAATTTGCTTAGTTTGAAATGGGAAAATATCTGAAGATCT
GACATGCAACTCAATTATAAATATAAGTATGTTGCTTGGTTATTAGTCGAAGCATACAATCTTATTTCTTCACATTTTATGATCTAGTGA
AAACTGAAAACTATGGATTACATTTAGATGAGGAACTTTTGGTAATAGGATGATTTGTTAT
(5')ATGGCCATGCTTCAATTATATTTTA
TTGCATATGCAGGAGGACTAGXTTCATCATTGAATAAAGAAGCATTACACTTGTCAAATTTATCGGAGTCCTCTAAACTGAAACTCCCTG
ATGCATCACTTCTATTAAATTCACCTACAATGCCAGGCCATCTTGGACTCAATACTGACCATTCTTCCCGAGTTGCAGCAGCCATGGCTG
AAAATGCAACAAGGAAGCGGGATATAAATGTATCAGCATCCACTTATCCACGCAGTAAGATTCCTAAAGGAACTTTGCCTAACATGAAGA
ATGTCCCTGAAACAGGAGGTGGTCTTXTTGCTCCCACCTCAACTTACCGGAAGGAGCAATATTGTTACAGAAGACATCAGCAAGCTATTT
CGGAAGAAGACCTCGTCTTAGTTGCACACAGAGtAAGAGAATGAAGTCACTGTTGACCTAACTGTAGTTTAA\(3')TTTCAGTGGATTC
TGTATCAGATTTTAGTAAGAAATTGACAGAAATGTTGTAAGATATTTGGTTATGTTGATACTAGGATGGCTATCAGCCGTTCTGGTTGTG
TTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACCCGGGGGGGGGGGCCGGGCCC
CCTTTCCCCCTTAAGGGGGGTAAAATAAATTTCCGGGGGCCCTTTTTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan