ESTScan Details for Unigene SGN-U220189

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
MDAGSRYNKFRPPLVNQMSHKKRTRENLDRFIPNRSAMDFDYAHYMLSGGKVKKEHYGVNSPSKEAYSKQLAEIFNMNRTRILAFKNKPP
HSAERVSESPSSIQQPKTVKKRRYIPQSSERTLDAPDILDDFYLNLLDWGSNNVIAIALGNSVYLWDASDGSVTELLTVDDDFGPVTAVS
WSPDGRSLAVGLNNSHVQLWNTLQGSSRLLRTLQGHRLRVGSLDWNGHILTTGGMDGMIINNDVV
Predicted Coding Sequence 
ATGGATGCAGGGAGCAGATACAATAAGTTTCGACCTCCTCTCGTTAATCAGATGTCTCACAAGAAAAGAACTCGAGAGAATCTGGACAGG
TTTATACCCAATCGTTCTGCGATGGATTTTGACTATGCACATTACATGCTCAGTGGTGGGAAGGTTAAAAAGGAACACTATGGAGTAAAT
TCTCCATCTAAAGAAGCTTACTCGAAGCAGTTAGCAGAAATTTTCAACATGAACAGAACGAGGATCCTTGCTTTTAAGAATAAGCCTCCA
CATTCGGCTGAGAGAGTTTCTGAATCTCCATCATCTATACAACAGCCAAAAACCGTTAAAAAGAGGAGATACATTCCCCAATCTTCGGAG
AGGACCCTGGATGCTCCTGACATCCTAGATGACTTTTATCTCAATTTGTTAGACTGGGGAAGCAATAACGTAATTGCCATTGCCTTAGGA
AATTCTGTATATCTATGGGATGCTTCTGATGGGTCTGTTACTGAGCTTCTCACGGTTGATGATGATTTTGGGCCGGTGACTGCTGTCAGC
TGGTCACCAGATGGAAGAAGCCTTGCAGTGGGCTTGAATAATTCACACGTTCAGCTGTGGAACACCTTGCAGGGATCTAGCCGATTGCTG
AGGACTTTACAAGGACACAGATTAAGGGTTGGCTCACTCGATTGGAATGGACACATACTGACAACTGGGGGCATGGACGGTATGATCATC
AACAATGACGTGGTX\
Edits in Original Sequence 
CGCTGAAGAAATTCAATACGCCATTGACGCTCTTTATCAAGAAATTCTCATATTGATCTGCTAAAGACGACGCTGCTATTATTAACACTG
TTCATTGGTTTATCTCTGTTGTTTCGCAATTTTGCCGTTTTGTATTTGATAGAGTAATTCTCTTTTTTCTGTATCT
(5')ATGGATGCAG
GGAGCAGATACAATAAGTTTCGACCTCCTCTCGTTAATCAGATGTCTCACAAGAAAAGAACTCGAGAGAATCTGGACAGGTTTATACCCA
ATCGTTCTGCGATGGATTTTGACTATGCACATTACATGCTCAGTGGTGGGAAGGTTAAAAAGGAACACTATGGAGTAAATTCTCCATCTA
AAGAAGCTTACTCGAAGCAGTTAGCAGAAATTTTCAACATGAACAGAACGAGGATCCTTGCTTTTAAGAATAAGCCTCCACATTCGGCTG
AGAGAGTTTCTGAATCTCCATCATCTATACAACAGCCAAAAACCGTTAAAAAGAGGAGATACATTCCCCAATCTTCGGAGAGGACCCTGG
ATGCTCCTGACATCCTAGATGACTTTTATCTCAATTTGTTAGACTGGGGAAGCAATAACGTAATTGCCATTGCCTTAGGAAATTCTGTAT
ATCTATGGGATGCTTCTGATGGGTCTGTTACTGAGCTTCTCACGGTTGATGATGATTTTGGGCCGGTGACTGCTGTCAGCTGGTCACCAG
ATGGAAGAAGCCTTGCAGTGGGCTTGAATAATTCACACGTTCAGCTGTGGAACACCTTGCAGGGATCTAGCCGATTGCTGAGGACTTTAC
AAGGACACAGATTAAGGGTTGGCTCACTCGATTGGAATGGACACATACTGACAACTGGGGGCATGGACGGTATGATCATCAACAATGACG
TGcGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan