ESTScan Details for Unigene SGN-U220279

Score 
138
Direction 
Reverse
Predicted Peptide Sequence 
TDYYGGGANMNSGYASGGYNASYGTAGVTSAWANQPHFAPLANSVVLSSSTLAKLLTLEVTLAIPHSC
Predicted Coding Sequence 
XXTACCGACTATTATGGTGGTGGTGCCAATATGAACAGTGGCTATGCATCTGGGGGGTATAATGCATCGTATGGAACAGCAGGCGTGACC
AGTGCATGGGCTAACCAGCCTCATTTCGCCCCACTAGCTAATTCAGTTGTACTTTCAAGTTCTACTCTAGCAAAACTACTCACTTTAGAG
GTTACTCTTGCTATTCCTCACTCTTGTTAG\
Edits in Original Sequence 
(5')XXTACCGACTATTATGGTGGTGGTGCCAATATGAACAGTGGCTATGCATCTGGGGGGTATAATGCATCGTATGGAACAGCAGGCGT
GACCAGTGCATGGGaCTAACCAGCCTCATTTCGCCCCACTAGCTAATTCAGTTGTACTTTCAAGTTCTACTCTAGCAAAACTACTCACTT
TAGAGGTTACTCTTGCTATTCCTCACTCTTGTTAG\(3')TTTCTCTTCCGTTGTACTCGAGTTTTTACTTTCCATGGTGGTGTTGTCGT
TCGTGACATATAGTTCAGGGCTCTAGGGGATGCGTAAATCTTGGCAGGTCCGCGGCAAATAATGACTAACACATTAGGAATTTTTTGCCT
CATTAGAAATGTGGTTTATACTTCTCTTAACTCAATTTTGTTGGTTGTAGATCTCTTCTGCAGAGCCCTTTGAACCAAATGTTTGAAGTT
ATGTTTCTACTTTAGTCAGTACTGTTGTAATATTCTGAAGTCTTTCTTATTAATCAAATTTTCTATTTTATACATAAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan