ESTScan Details for Unigene SGN-U220574

Score 
773
Direction 
Forward
Predicted Peptide Sequence 
EEKIPXNPLFLRNYAQLLQLLRNALFIAEGLAETTSLLYEIKESXKGDLPGAEHYYFQATLADPKDGDTLSQYAKLVWELHQDKDRASDY
FERAVRTAPENSHVLGAYASFLWDITDDESEDEMNTQSDKTKIEESGEATVSRNLDYEEADRPVSPPLHLAAGXRNWVNLVGGSSPVDYT
AAVSDMDGNAEEEYMRMIKEYPHHSVLLRNYAQFLSQSKGDLLGAEEYYSHAILADPTDGETISQYAMLIWQLHQDKDKASTYFKRAVQA
SPQDSDVLAAYARFLWQTEEDEDGEEDETLGDHNGAPLLQGVA
Predicted Coding Sequence 
GAGGAGAAGATCCCTGXTAACCCTTTGTTTTTGAGGAATTATGCTCAACTTTTGCAGTTGCTTAGAAATGCTTTATTTATAGCCGAGGGT
CTAGCGGAAACAACCTCTCTACTCTATGAGATAAAGGAAAGTXCTAAGGGAGATCTTCCTGGAGCTGAACACTATTACTTTCAAGCTACA
CTAGCTGATCCAAAAGATGGAGATACCTTGTCACAGTATGCTAAGTTAGTATGGGAGCTGCACCAAGATAAAGATAGAGCATCAGATTAC
TTTGAACGTGCAGTACGTACTGCTCCTGAGAACAGCCATGTTCTTGGAGCATATGCTAGTTTCCTCTGGGACATTACTGACGATGAAAGT
GAGGATGAAATGAACACACAGAGTGATAAGACTAAGATTGAGGAAAGTGGGGAAGCTACTGTATCCCGGAACTTAGATTACGAAGAAGCT
GACAGACCTGTTAGCCCTCCCTTACATCTTGCAGCAGGATTXAGGAATTGGGTTAATCTAGTTGGTGGCAGCTCTCCTGTTGATTATACT
GCAGCTGTATCTGATATGGACGGAAATGCCGAGGAGGAGTACATGAGAATGATCAAAGAATATCCTCATCACTCCGTGCTTTTAAGAAAC
TATGCTCAGTTTCTTAGTCAGTCTAAGGGAGACCTACTAGGTGCTGAAGAATATTACTCACACGCAATACTAGCTGATCCTACTGATGGA
GAAACTATTTCACAGTATGCCATGTTGATATGGCAACTTCATCAGGATAAAGATAAAGCCTCAACCTACTTTAAGAGGGCAGTACAAGCT
TCTCCACAAGACAGCGACGTGCTTGCTGCATATGCTAGGTTTCTCTGGCAAACAGAGGAAGATGAAGACGGAGAAGAAGATGAAACGTTA
GGTGATCACAATGGAGCGCCACTTCTGCAAGGAGTCGCCTAA\
Edits in Original Sequence 
(5')GAGGAGAAGATCCCTGXTAACCCTTTGTTTTTGAGGAATTATGCTCAACTTTTGCAGTTGCTTAGAAATGCTTTATTTATaAGCCG
AGGGTCTAGCGGAAACAACCTCTCTAtCTCTATGAGATAAAGGAAAGTXCTAAGGGAGATCTTCCTGGAGCTGAACACTATTACTTTCAA
GCTACACTAGCTGATCCAAAAGATGGAGATACCTTGTCACAGTATGCTAAGTTAGTATGGGAGCTGCACCAAGATAAAGATAGAGCATCA
GATTACTTTGAACGTGCAGTACGTACTGCTCCTGAGAACAGCCATGTTCTTGGAGCATATGCTAGTTTCCTCTGGGACATTACTGACGAT
GAAAGTGAGGATGAAATGAACACACAGAGTGATAAGACTAAGATTGAGGAAAGTGGGGAAGCTACTGTATCCCGGAACTTAGATTACGAA
GAAGCTGACAGACCTGTTAGCCCTCCCTTACATCTTGCAGCAGGATTXAGGAATTGGGTTAATCTAGTTGGTGGCAGCTCTCCTGTTGAT
TATACTGCAGCTGTATCTGATATGGACGGAAATGCCGAGGAGGAGTACATGAGAATGATCAAAGAATATCCTCATCACTCCGTGCTTTTA
AGAAACTATGCTCAGTTTCTTAGTCAGTCTAAGGGAGACCTACTAGGTGCTGAAGAATATTACTCACACGCAATACTAGCTGATCCTACT
GATGGAGAAACTATTTCACAGTATGCCATGTTGATATGGCAACTTCATCAGGATAAAGATAAAGCCTCAACCTACTTTAAGAGGGCAGTA
CAAGCTTCTCCACAAGACAGCGACGTGCTTGCTGCATATGCTAGGTTTCTCTGGCAAACAGAGGAAGATGAAGACGGAGAAGAAGATGAA
ACGTTAGGTGATCACAATGGAGCGCCACTTCTGCAAGGAGTCGCCTAA\(3')AGCCTGATGTCAAATGAATTTCACAATCCAGATTCTA
ATTCATATTTTAGTTTCTCAAGCTTTTCGCATTATCTAAAGACTTGGAGATTTCTCTTGTTGTGGAGGATCAACTATTCTGGGAAAATTT
TTAGATGGTAAGTGTTGTTTAATGAGCAATAAAATGTGCACAATAATGTTAAATTGACTTTGTACAATGTTATTTTTGGGAATAATGATA
GCAGTTGAAAGAGTTGAATGAAAAATTAAATAGTGACTCTGCATTGTAGTAATATACTGTTTTGTACCTCTATTTGTATACAACATTCAC
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan