Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U220598

Score 
495
Direction 
Forward
Predicted Peptide Sequence 
MAARVPLGCEPVVGSLTPSRKKEYRVTNRLQEGKRPLYGVVFNFIDSRYFNVFATVGGNRVTVYQCLEGGVIAVLQSYIDEDKDESFYTV
SWACNIDGSPFLVAGGINGVIRVIDAGKEKLHKSFVGHGDSVNEIRTQPLKPSLVLSASKDESVRLWNVHTGICILVFAGAGGHRNEVLS
VDFHPTDIYRIASCGMDNTV
Predicted Coding Sequence 
ATGGCGGCCAGAGTACCTCTAGGATGTGAGCCAGTTGTTGGATCATTAACACCGTCAAGGAAAAAGGAGTATAGAGTGACGAACAGACTC
CAAGAAGGCAAACGCCCATTATATGGCGTCGTCTTCAATTTCATTGATTCGCGCTACTTCAATGTCTTTGCTACTGTGGGCGGAAATCGT
GTGACTGTATATCAGTGTCTCGAAGGTGGTGTCATTGCTGTGCTGCAGTCTTATATTGATGAAGATAAAGATGAATCCTTTTACACTGTA
AGTTGGGCCTGCAATATTGATGGAAGTCCATTCTTAGTGGCTGGTGGAATAAATGGAGTTATTCGTGTTATTGATGCTGGGAAAGAGAAG
CTACACAAGAGCTTTGTGGGGCACGGAGACTCAGTAAATGAAATTAGGACTCAACCCTTGAAACCATCTCTTGTATTATCTGCCAGCAAA
GATGAATCTGTTCGCTTGTGGAATGTTCATACTGGAATATGCATTTTGGTATTTGCTGGCGCTGGAGGTCATCGGAATGAAGTACTTAGT
GTGGACTTCCATCCTACTGATATATATCGGATTGCTAGCTGTGGAATGGATAACACTGTT\
Edits in Original Sequence 
AGTTTTTTTTTTAACAAATATTCCAAGGACACTGTAAATATGTAGAGTTTTTCGTTCCTCTCTAAGCTCTGGCGGAGTGATAGCA(5')A
TGGCGGCCAGAGTACCTCTAGGATGTGAGCCAGTTGTTGGATCATTAACACCGTCAAGGAAAAAGGAGTATAGAGTGACGAACAGACTCC
AAGAAGGCAAACGCCCATTATATGGCGTCGTCTTCAATTTCATTGATTCGCGCTACTTCAATGTCTTTGCTACTGTGGGCGGAAATCGTG
TGACTGTATATCAGTGTCTCGAAGGTGGTGTCATTGCTGTGCTGCAGTCTTATATTGATGAAGATAAAGATGAATCCTTTTACACTGTAA
GTTGGGCCTGCAATATTGATGGAAGTCCATTCTTAGTGGCTGGTGGAATAAATGGAGTTATTCGTGTTATTGATGCTGGGAAAGAGAAGC
TACACAAGAGCTTTGTGGGGCACGGAGACTCAGTAAATGAAATTAGGACTCAACCCTTGAAACCATCTCTTGTATTATCTGCCAGCAAAG
ATGAATCTGTTCGCTTGTGGAATGTTCATACTGGAATATGCATTTTGGTATTTGCTGGCGCTGGAGGTCATCGGAATGAAGTACTTAGTG
TGGACTTCCATCCTACTGATATATATCGGATTGCTAGCTGTGGAATGGATAACACTGTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan