ESTScan Details for Unigene SGN-U220670

Score 
1434
Direction 
Forward
Predicted Peptide Sequence 
NFFDHVSHPRPQPPQNSTATPISIYDLQFHLNNRRTRTDQTNNLMSEFNNSLIFDTTTGSITFPPTSQQHDAGDGNVSAITVTEQSAGAA
DPSIAEQARNPKKRSRASRKAPTTVLTTDANNFRAMVQEFTGIPGPPFAAPPIIPIRNRFDLFPTVPNSVAPTPIANNNTFLISQPSPNY
LQRPFPQTIQPPPPYLGPSSSSASAFNRLPINMASASSASTSATHSAFNYQLPSGVAHPLPINIASAPSTSTSATRHSAFNYQIPIGVAN
SVAHRGLPINIASAPSTSTSATHHSAFNYQLPNGVANAVAHRGLPINIASAPSTSTGATHSAINHQLSSGVANLPINIASAPSASTSAAH
SATNYQLPSEVANSVAHGSNNFNSVQHNSIFTSLLQCSQKYQFGSKEPQPFQMPSNNIVSQFQMPSNSISQFQMTSSLNNSTQHGYLLSE
LPNLISEEQAATTSSMNESRINATNFHGDNLREAVNATNFHGDNLQETVVATNFHGDQVQETVIPTDFDGDKVQETVSNKGVEGMVESWL
LSTD
Predicted Coding Sequence 
AACTTTTTCGACCACGTATCCCACCCCCGCCCCCAACCACCACAGAACAGCACAGCCACCCCAATTTCAATTTACGATCTTCAGTTCCAT
TTGAACAATAGAAGGACAAGAACCGATCAAACCAACAACCTGATGTCTGAGTTTAATAATTCCTTAATTTTTGATACTACTACTGGTAGT
ATTACTTTCCCACCGACATCACAGCAACACGACGCCGGTGATGGAAATGTAAGTGCTATTACTGTTACCGAACAGTCGGCAGGTGCAGCG
GATCCATCAATTGCCGAACAGGCACGGAATCCGAAGAAAAGATCGAGAGCTTCGAGGAAGGCACCAACTACTGTGTTGACAACAGATGCA
AATAATTTCAGAGCTATGGTTCAAGAATTTACAGGGATTCCAGGACCACCCTTTGCTGCTCCTCCTATTATCCCTATTCGAAACAGATTT
GATTTGTTTCCTACTGTGCCTAATTCTGTTGCTCCTACTCCTATCGCCAATAATAATACTTTCCTCATTTCACAACCATCGCCTAATTAT
CTACAAAGGCCTTTTCCTCAGACAATTCAGCCGCCACCACCCTATCTTGGTCCTTCTTCATCGTCAGCGTCTGCGTTCAATCGTTTACCT
ATCAACATGGCTTCTGCTTCATCAGCATCTACTAGTGCTACTCATTCTGCTTTTAACTATCAACTTCCCAGCGGAGTGGCACATCCTTTA
CCTATCAACATTGCTTCTGCTCCATCAACATCTACGAGTGCTACTCGTCATTCTGCTTTTAACTATCAGATTCCCATCGGAGTTGCTAAT
TCTGTAGCACATCGAGGTTTACCTATCAACATTGCTTCTGCTCCATCAACATCTACTAGTGCTACTCATCATTCTGCTTTTAACTATCAA
CTTCCCAACGGAGTTGCTAATGCTGTAGCACATCGAGGTTTACCTATCAACATTGCTTCTGCTCCATCAACATCTACAGGTGCTACTCAT
TCTGCTATTAACCATCAACTTTCCAGCGGAGTTGCTAATTTACCTATCAACATTGCTTCTGCTCCATCAGCATCTACTAGTGCTGCTCAT
TCTGCTACTAACTATCAACTTCCCAGTGAAGTTGCCAATTCTGTGGCACATGGTTCTAATAATTTCAATTCAGTTCAACACAACTCAATC
TTCACATCACTTCTTCAATGCTCACAAAAATACCAATTTGGGTCGAAAGAACCACAACCATTCCAAATGCCATCAAATAACATTGTCTCC
CAGTTCCAAATGCCATCAAATAGCATTTCTCAATTCCAAATGACATCAAGTTTGAACAACAGCACCCAGCATGGATATCTTCTGAGTGAG
CTTCCCAATCTGATTTCTGAAGAACAAGCAGCAACCACATCGTCCATGAACGAGAGCCGTATCAATGCAACAAATTTTCATGGCGATAAT
TTGCGGGAAGCAGTCAATGCAACAAATTTTCATGGCGATAATTTGCAGGAGACAGTGGTTGCAACAAATTTTCATGGGGACCAGGTGCAG
GAAACAGTGATTCCAACAGATTTTGACGGCGATAAGGTGCAGGAAACAGTGTCCAACAAGGGTGTTGAAGGTATGGTGGAATCATGGCTT
CTTTCTACAGATTAG\
Edits in Original Sequence 
(5')AACTTTTTCGACCACGTATCCCACCCCCGCCCCCAACCACCACAGAACAGCACAGCCACCCCAATTTCAATTTACGATCTTCAGTT
CCATTTGAACAATAGAAGGACAAGAACCGATCAAACCAACAACCTGATGTCTGAGTTTAATAATTCCTTAATTTTTGATACTACTACTGG
TAGTATTACTTTCCCACCGACATCACAGCAACACGACGCCGGTGATGGAAATGTAAGTGCTATTACTGTTACCGAACAGTCGGCAGGTGC
AGCGGATCCATCAATTGCCGAACAGGCACGGAATCCGAAGAAAAGATCGAGAGCTTCGAGGAAGGCACCAACTACTGTGTTGACAACAGA
TGCAAATAATTTCAGAGCTATGGTTCAAGAATTTACAGGGATTCCAGGACCACCCTTTGCTGCTCCTCCTATTATCCCTATTCGAAACAG
ATTTGATTTGTTTCCTACTGTGCCTAATTCTGTTGCTCCTACTCCTATCGCCAATAATAATACTTTCCTCATTTCACAACCATCGCCTAA
TTATCTACAAAGGCCTTTTCCTCAGACAATTCAGCCGCCACCACCCTATCTTGGTCCTTCTTCATCGTCAGCGTCTGCGTTCAATCGTTT
ACCTATCAACATGGCTTCTGCTTCATCAGCATCTACTAGTGCTACTCATTCTGCTTTTAACTATCAACTTCCCAGCGGAGTGGCACATCC
TTTACCTATCAACATTGCTTCTGCTCCATCAACATCTACGAGTGCTACTCGTCATTCTGCTTTTAACTATCAGATTCCCATCGGAGTTGC
TAATTCTGTAGCACATCGAGGTTTACCTATCAACATTGCTTCTGCTCCATCAACATCTACTAGTGCTACTCATCATTCTGCTTTTAACTA
TCAACTTCCCAACGGAGTTGCTAATGCTGTAGCACATCGAGGTTTACCTATCAACATTGCTTCTGCTCCATCAACATCTACAGGTGCTAC
TCATTCTGCTATTAACCATCAACTTTCCAGCGGAGTTGCTAATTTACCTATCAACATTGCTTCTGCTCCATCAGCATCTACTAGTGCTGC
TCATTCTGCTACTAACTATCAACTTCCCAGTGAAGTTGCCAATTCTGTGGCACATGGTTCTAATAATTTCAATTCAGTTCAACACAACTC
AATCTTCACATCACTTCTTCAATGCTCACAAAAATACCAATTTGGGTCGAAAGAACCACAACCATTCCAAATGCCATCAAATAACATTGT
CTCCCAGTTCCAAATGCCATCAAATAGCATTTCTCAATTCCAAATGACATCAAGTTTGAACAACAGCACCCAGCATGGATATCTTCTGAG
TGAGCTTCCCAATCTGATTTCTGAAGAACAAGCAGCAACCACATCGTCCATGAACGAGAGCCGTATCAATGCAACAAATTTTCATGGCGA
TAATTTGCGGGAAGCAGTCAATGCAACAAATTTTCATGGCGATAATTTGCAGGAGACAGTGGTTGCAACAAATTTTCATGGGGACCAGGT
GCAGGAAACAGTGATTCCAACAGATTTTGACGGCGATAAGGTGCAGGAAACAGTGTCCAACAAGGGTGTTGAAGGTATGGTGGAATCATG
GCTTCTTTCTACAGATTAG\(3')AAAAAAAGAAGATTATAATTGAAGTCATGATTATGTGATCATAACAATAATGAAGAGGGTAAAAGA
AAAGAGATTTAGTAATTAGTGCTAGCTTACAATCATGTTCTATAAATCATGATTTTCCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan