ESTScan Details for Unigene SGN-U220937

Score 
1152
Direction 
Reverse
Predicted Peptide Sequence 
MGEEEKKPAEEVKKTEEEKKEDAPKVDEKTEEKKTEEAPAPPQEIVLRVYMHCEGCARKVRKSLKGFQGVEDVITDCKSHKVVVKGEKAD
PLKVLERVQKKSHRKVELLSPIPKPPAEEAKKPEEKEIVKPEEKKEEPPQVITVVLKVHMHCEACAQEIKRRIQKMKGVENAEPDLKNSQ
VAVKGVFEATQLLDYVSRRTGKRAVLVKVEPEKKEEEKP
Predicted Coding Sequence 
ATGGGCGAGGAAGAGAAGAAGCCTGCAGAAGAAGTGAAGAAAACAGAGGAAGAGAAGAAAGAGGATGCACCAAAAGTTGATGAAAAAACA
GAGGAGAAGAAAACAGAGGAAGCACCAGCTCCTCCACAAGAAATTGTTTTGAGAGTTTACATGCATTGTGAAGGATGTGCTCGTAAAGTT
CGTAAATCACTTAAAGGATTTCAAGGAGTTGAGGATGTTATAACTGATTGTAAGAGTCATAAAGTGGTGGTGAAAGGGGAAAAAGCAGAT
CCATTGAAGGTTCTTGAAAGAGTTCAAAAAAAGAGTCACCGGAAAGTTGAGCTTCTGTCTCCGATCCCAAAACCGCCGGCGGAAGAGGCT
AAGAAGCCGGAAGAGAAAGAAATTGTTAAACCAGAAGAGAAAAAAGAAGAGCCTCCTCAAGTGATTACTGTAGTTCTGAAAGTTCACATG
CATTGTGAAGCTTGTGCTCAAGAAATCAAAAGGCGTATACAGAAAATGAAAGGTGTTGAGAATGCAGAACCAGATTTGAAGAACTCACAA
GTAGCAGTAAAAGGGGTTTTTGAGGCAACACAGCTGTTGGACTATGTAAGCAGGAGAACAGGGAAAAGGGCAGTTCTAGTGAAAGTAGAA
CCAGAAAAGAAAGAAGAGGAGAAACCT\
Edits in Original Sequence 
GCACCAGAAGTGACTAGTGAGTGAGTGCCTCGTAGATTATCTCTATTGTCATCACTGTTAACCTTTTCTTGAGAATAACAACAACACTCA
CCATAACATAAACAAAAAGAGAGAGAGGAAAAAGAAAACAAACTGAGCTGTGTAAAAGTTGTGAGTTGAGTCTCTCTGCATAAGCTTATC
CAACAATATCA
(5')ATGGGCGAGGAAGAGAAGAAGCCTGCAGAAGAAGTGAAGAAAACAGAGGAAGAGAAGAAAGAGGATGCACCAAAA
GTTGATGAAAAAACAGAGGAGAAGAAAACAGAGGAAGCACCAGCTCCTCCACAAGAAATTGTTTTGAGAGTTTACATGCATTGTGAAGGA
TGTGCTCGTAAAGTTCGTAAATCACTTAAAGGATTTCAAGGAGTTGAGGATGTTATAACTGATTGTAAGAGTCATAAAGTGGTGGTGAAA
GGGGAAAAAGCAGATCCATTGAAGGTTCTTGAAAGAGTTCAAAAAAAGAGTCACCGGAAAGTTGAGCTTCTGTCTCCGATCCCAAAACCG
CCGGCGGAAGAGGCTAAGAAGCCGGAAGAGAAAGAAATTGTTAAACCAGAAGAGAAAAAAGAAGAGCCTCCTCAAGTGATTACTGTAGTT
CTGAAAGTTCACATGCATTGTGAAGCTTGTGCTCAAGAAATCAAAAGGCGTATACAGAAAATGAAAGGTGTTGAGAATGCAGAACCAGAT
TTGAAGAACTCACAAGTAGCAGTAAAAGGGGTTTTTGAGGCAACACAGCTGTTGGACTATGTAAGCAGGAGAACAGGGAAAAGGGCAGTT
CTAGTGAAAGTAGAACCAGAAAAGAAAGAAGAGGAGAAACCT\(3')AAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan