ESTScan Details for Unigene SGN-U220992

Score 
145
Direction 
Forward
Predicted Peptide Sequence 
MAMSSKNNRMQFLLYELLIIHKKKRVLRTHSSSHDDPTTSNAAAIATSSMQEERKLQRIRPLLSPCLSYSVLTNLYNPIMLSPSGLYGLR
FHFSHRSTPPPMVFIRLSVSLHSSTPCRLPTSSSKFFILCISEFXSSPTQEDRVLKLKERSSCTCARKSILELGTPVQKISLKFRAHPRL
KGFIFLSNDTGIFICGLVCDYQVQGNAVRPPRNQETTNVYIIRMPEAGXLKKCTPNVTIVCIHNLLYIYPAESKDIEAQEVCDETNXEKV
TIVPLPNALSQPRAMVVEALNAIVAYGAMRX
Predicted Coding Sequence 
ATGGCAATGTCATCAAAGAATAATAGAATGCAATTCCTTCTCTATGAGCTGCTAATCATTCACAAGAAAAAGAGAGTATTGAGAACCCAC
TCCTCCAGCCACGACGATCCTACAACTTCAAATGCTGCAGCAATAGCCACGTCATCAATGCAGGAAGAACGAAAACTTCAACGAATTAGA
CCACTTCTTTCTCCCTGTCTTTCATATAGTGTTCTTACTAATCTGTACAACCCGATTATGTTATCTCCCAGTGGCCTTTATGGTCTCCGC
TTTCATTTCTCACATCGATCTACCCCACCACCTATGGTTTTTATCCGGCTGTCTGTTTCTTTACACTCATCAACACCCTGTCGTCTGCCA
ACTTCCTCGTCAAAGTTCTTCATTTTGTGCATATCTGAATTTGXTAGTAGCCCCACCCAAGAAGATAGGGTGTTGAAGCTTAAAGAGCGA
TCAAGCTGCACGTGTGCACGGAAATCGATCCTGGAACTTGGCACACCGGTGCAAAAGATCTCATTAAAATTCCGAGCACATCCAAGATTA
AAAGGATTCATCTTCCTCTCAAACGATACCGGAATTTTCATATGTGGTCTGGTTTGTGATTATCAAGTACAAGGAAATGCTGTGAGACCT
CCAAGAAACCAAGAAACTACAAACGTATACATTATAAGGATGCCTGAAGCAGGTGXACTTAAAAAATGCACTCCAAATGTTACAATTGTG
TGCATCCATAATCTTCTTTATATTTACCCAGCAGAAAGCAAAGACATAGAGGCTCAGGAAGTTTGTGATGAAACAAACXATGAAAAAGTA
ACGATAGTTCCTCTTCCCAATGCACTGTCCCAACCACGGGCAATGGTGGTCGAAGCGCTCAATGCAATTGTCGCATATGGAGCAATGAGA
GXX\
Edits in Original Sequence 
TTTTTTTTTTTTTTCTGTTAGAAACCCCCACTTAATATTTATAAATAATTTANTTCGAAACCTAATAAGCTGTCTTTTCTAGAATCCAAA
ACCTAAAACTCAAAAGAAGCTTAATAACGTCCTAGTTATGCATGCCATTTTCAATCTCATAGCCATAAACTCCAATTTTTAGAAATATAA
ACTTGCAGCAGTATCTTACAACTTCTCCAGAAAAACATTCATTGA
(5')ATGGCAATGTCATCAAAGAATAATAGAATGCAATTCCTaTC
TCTATGAGCTGCTAATCATTCACAAGAAAAAGAGAGTATTGAGAACCCACTCCTCCAGCCACGACGATCCTACAACTTCAAATGCTGCAG
CAATAGCCACGTCATCAATGCAGGAAGAACGAAAACTTCAACGAATTAGACCACTTCTTTCTCCCTGTCTTTCATATAGTGTTCTgTACT
AATCTGTACAACCCGATTATGTTATCTCCCAGTGGCCTTTATGGTCTCCGCTTTCATTTCTCACATCGATCTACCCCACCACCTATGGTT
TTTATCCGGCTGTCTGTTTCTTTACACTCATCAACACCCTGTCGTCTGCCAACTTCCTCGTCAAAGTTCTTCATTTTGTGCATATCTGAA
TTTGXTAGTAGCCCCACCCAAGtAAGATAGGGTGTTGAAGCTTAAAGAGCGATCAAGCTGCACGTGTGCACGGAAATCGATCCTGGAACT
TGGCACACCGGTGCAAAAGATCTCATTAAAATTCCGAGCACATCCAAGATTAAAAGGATTCATCTTCCTCTCAtAACGATACCGGtAATT
TTCATATGTGGTCTGGTTTGTGATTATCAAGTACAAGtGAAATGCTGTGAGACCTCCAAGAAACCAAGAAACTACAAACGTATACATTAT
AAGGATGCCTGAAGCAGGTGXACTTAAAAAATGCACTCCAAATGTTACAATTGTGTGCATCCATAATCTTCTTTATATTTACCCAGCAGA
AAGCAAAGACATAGAGGCTCAGGAAGTTTGTaGATGAAACAAACXATGAAAAAGTAACGATAGTTCCTCTTCCCAATGCACTGTCCCAAC
CACGGGCAATGGTGGTCGAAGCGCTCAATGCAATTGTCGCATATGGAGCAATGAGAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan