ESTScan Details for Unigene SGN-U220995

Score 
-170
Direction 
Reverse
Predicted Peptide Sequence 
SIRNMLPAISQSMGKSARKLHFVQLSSVGAYGSARGDRVVTEATPCKPKGTYEVTKTEADELIVSSAQQHGFTFTIVRPSNIFAADMPNS
SLRQLANMIRRGLFFFVGPRGAISTYVHVDDVVDVLLKAGFDERARNNIYNVSNDCPLEEMVEGLAAAVGVAKPRYRVPEFIVRGTVKFT
SLFMAIPVTQERIDSLVSRTTYSMNKLKSELDFTPMHSVPEHIGEVIPKXMSIFDMGWSESYEATMASVRREKLGVVKNIKIARVA
Predicted Coding Sequence 
TCGATTAGGAATATGCTCCCGGCGATCAGTCAATCTATGGGGAAGTCTGCGAGAAAGTTGCATTTTGTACAATTGAGTAGTGTGGGTGCC
TACGGTTCGGCGCGTGGGGATAGAGTCGTTACTGAGGCGACGCCCTGTAAACCAAAGGGTACTTACGAAGTAACCAAAACCGAAGCAGAT
GAATTAATTGTTTCCTCCGCGCAGCAACATGGCTTTACATTCACTATTGTCCGACCTTCTAATATTTTTGCCGCTGATATGCCCAACTCA
TCCCTGCGTCAGTTGGCCAATATGATTAGGCGAGGCCTTTTCTTTTTCGTTGGGCCGCGAGGTGCGATTTCTACCTACGTTCATGTCGAT
GACGTGGTAGACGTGTTGCTGAAGGCCGGCTTTGATGAGCGGGCGCGAAACAATATCTACAACGTTTCCAACGACTGTCCCTTAGAGGAG
ATGGTCGAGGGGCTGGCAGCCGCGGTGGGTGTTGCGAAACCAAGATACCGAGTTCCTGAATTTATCGTTAGAGGAACTGTGAAATTCACA
TCCTTGTTCATGGCTATACCGGTTACTCAGGAGCGAATTGATTCACTGGTTAGTCGGACCACCTACAGCATGAATAAGCTGAAATCCGAA
TTGGATTTCACGCCTATGCATTCGGTTCCTGAGCATATAGGTGAGGTTATTCCAAAGTAXATGTCGATTTTCGATATGGGTTGGAGTGAA
TCTTATGAAGCGACAATGGCGTCGGTACGAAGGGAGAAACTAGGTGTTGTAAAAAATATTAAAATAGCGAGAGTGGCG\
Edits in Original Sequence 
(5')TCGATTAGGAATATGCTCCCGGCGATCAGTCAATCTATGGGGAAGTCTGCGAGAAAGTTGCATTTTGTACAATTGAGTAGTGTGGG
TGCCTACGGTTCGGCGCGTGGGGATAGAGTCGTTACTGAGGCGACGCCCTGTAAACCAAAGGGTACTTACGAAGTAACCAAAACCGAAGC
AGATGAATTAATTGTTTCCTCCGCGCAGCAACATGGCTTTACATTCACTATTGTCCGACCTTCTAATATTTTTGCCGCTGATATGCCCAA
CTCATCCCTGCGTCAGTTGGCCAATATGATTAGGCGAGGCCTTTTCTTTTTCGTTGGGCCGCGAGGTGCGATTTCTACCTACGTTCATGT
CGATGACGTGGTAGACGTGTTGCTGAAGGCCGGCTTTGATGAGCGGGCGCGAAACAATATCTACAACGTTTCCAACGACTGTCCCTTAGA
GGAGATGGTCGAGGGGCTGGCAGCCGCGGTGGGTGTTGCGAAACCAAGATACCGAGTTCCTGAATTTATCGTTAGAGGAACTGTGAAATT
CACATCCTTGTTCATGGCTATACCGGTTACTCAGGAGCGAATTGATTCACTGGTTAGTCGGACCACCTACAGCATGAATAAGCTGAAATC
CGAATTGGATTTCACGCCTATGCATTCGGTTCCTGAGCATATAGGTGAGGTTATTCCAAAGTAXATGTCGATTTTCGATATGGGTTGGAG
TGAATCTTATGAAGCGACAATGGCGTCGGTACGAAGGGAGAAACTAGGTGTTcGTAAAAAATATTAAAATAGCGAGAGTGGCG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan