ESTScan Details for Unigene SGN-U221128

Score 
872
Direction 
Forward
Predicted Peptide Sequence 
SASAQAGEREPNHSEDIKPDDTQVSTSKISNHSDTENDAQREEEFPEVRVDFQETFLGHTSPISRCRFSATGDNVASASVDGTVRIWTYD
SSAPTSRNATIYCGAEIMSLEWECKSDRLLLIGTADGGIKAWNVDAKRVVCDLSCTEAFPSVLDLKCSPVEPIFVSAAASRWPGLSDIGK
LGYASLTVWNMRTWKAMTVLPLGEDPPPITSVCFNHNGKLLAAAATDGMIHMFDMSAGLQITGWPAHDSAISSVMFGSDETSIFTLGIDG
KIFGGVCRIKAKYFGQVIAADSVTLGVRHTINMKWLSMLMEEASGDIQLPEGTYISGGGHAYGMRTLPHSASITTVDWHPTSPIFLTGSA
DHSVXGYIYGVTTSDLSGVFIWIVXLKGDELKMQYLFVHL
Predicted Coding Sequence 
XXCTCTGCAAGTGCACAAGCTGGTGAAAGAGAACCTAATCACAGTGAGGATATCAAGCCTGATGATACTCAAGTATCAACTTCTAAAATT
AGTAATCACAGTGACACTGAAAATGATGCACAACGAGAAGAAGAATTCCCTGAAGTGAGAGTGGACTTCCAGGAGACATTCTTAGGCCAC
ACAAGTCCAATAAGTCGTTGCCGTTTTTCTGCTACTGGGGACAATGTTGCTAGTGCTTCTGTGGATGGAACAGTCAGGATATGGACATAT
GACTCATCAGCACCAACATCAAGAAATGCAACCATCTATTGTGGGGCAGAGATCATGTCACTTGAGTGGGAGTGCAAATCTGACCGACTG
CTTCTCATAGGCACAGCTGATGGAGGAATCAAAGCATGGAATGTCGATGCTAAACGTGTTGTTTGTGATCTTAGTTGCACAGAAGCATTC
CCAAGCGTGTTGGATTTAAAATGCAGCCCTGTGGAGCCAATTTTCGTATCTGCTGCTGCTTCGAGATGGCCTGGTTTGAGTGACATTGGT
AAATTGGGCTATGCTTCTTTAACTGTCTGGAATATGAGGACATGGAAAGCTATGACAGTCCTGCCTCTTGGTGAAGATCCACCTCCAATT
ACTTCAGTATGCTTCAATCACAATGGAAAACTTTTAGCAGCTGCAGCTACTGATGGAATGATACACATGTTTGATATGTCTGCTGGCTTG
CAAATTACTGGATGGCCAGCACATGATTCTGCTATTAGTTCTGTTATGTTTGGTTCTGATGAGACGAGCATTTTCACTTTGGGTATAGAT
GGAAAGATATTTGGTGGAGTTTGCAGAATCAAGGCAAAGTACTTTGGTCAAGTGATTGCAGCAGATTCTGTAACCTTAGGAGTTCGTCAC
ACTATAAACATGAAATGGCTCTCGATGCTTATGGAAGAAGCTTCTGGTGACATCCAACTCCCTGAGGGCACCTATATATCAGGTGGAGGT
CATGCATATGGGATGAGAACTCTTCCGCATAGTGCATCTATAACAACAGTAGACTGGCATCCGACATCACCCATCTTCTTGACTGGATCT
GCAGATCACTCTGTTXCGGGTTACATCTATGGCGTGACAACTTCTGATTTGTCTGGTGTGTTTATTTGGATAGTTGAXCTTAAAGGAGAT
GAGTTGAAAATGCAATATTTATTCGTTCATCTX\
Edits in Original Sequence 
(5')XXCTCTGCAAGTGCACAAGCTGGTGAAAGAGAACCTAATCACAGTGAGGATATCAAGCCTGATGATACTCAAGTATCAACTTCTAA
AATTAGTAATCACAGTGACACTGAAAATGATGCACAACGAGAAGAAGAATTCCCTGAAGTGAGAGTGGACTTCCAGGAGACATTCTTAGG
CCACACAAGTCCAATAAGTCGTTGCCGTTTTTCTGCTACTGGGGACAATGTTGCTAGTGCTTCTGTGGATGGAACAGTCAGGATATGGAC
ATATGACTCATCAGCACCAACATCAAGAAATGCAACCATCTATTGTGGGGCAGAGATCATGTCACTTGAGTGGGAGTGCAAATCTGACCG
ACTGCTTCTCATAGGCACAGCTGATGGAGGAATCAAAGCATGGAATGTCGATGCTAAACGTGTTGTTTGTGATCTTAGTTGCACAGAAGC
ATTCCCAAGCGTGTTGGATTTAAAATGCAGCCCTGTGGAGCCAATTTTCGTATCTGCTGCTGCTTCGAGATGGCCTGGTTTGAGTGACAT
TGGTAAATTGGGCTATGCTTCTTTAACTGTCTGGAATATGAGGACATGGAAAGCTATGACAGTCCTGCCTCTTGGTGAAGATCCACCTCC
AATTACTTCAGTATGCTTCAATCACAATGGAAAACTTTTAGCAGCTGCAGCTACTGATGGAATGATACACATGTTTGATATGTCTGCTGG
CTTGCAAATTACTGGATGGCCAGCACATGATTCTGCTATTAGTTCTGTTATGTTTGGTTCTGATGAGACGAGCATTTTCACTTTGGGTAT
AGATGGAAAGATATTTGaGTGGAGTTTGCAGAATCAAGGCAAAGTACTTTGGTCAAGTGATTGCAGCAGATTCTGTAACCTTAGGAGTTC
GTCACACTATAAACATGAAATGGCTCTCGATGCTTATGGAAGAAGaCTTCTGGTGACATCCAACTCCCTGAGGGCACCTATATATCAGGT
GcGAGGTCATGCATATGGGATGAGAACTCTTCCGCATAGTGCATCTATAACAACAGTAGACTGGCATCCGACATCACCCATCTTCTTGAC
TGGATCTGCAGATCACTCTGTTXCGGGTTACATCTATGGCGTGACAACTTCTGATTTGTCTGGTGTGTTTATTTGGATAGTTGAXCTTAA
AGGAGATGAGTTGAAAATGCAATATTTATTCGTTCATCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan