Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U221143

Score 
732
Direction 
Forward
Predicted Peptide Sequence 
MAESKDFITXVYVHPSDNFNTGVRSKDVNNNSARLYLPKITEKEQKFPLLIYIHGGGFSIESAFSSGHDKYLHSIVTKANVVAISIDYRL
APEHLLPTCYDDSWSVIRWTSLHVEMCDHLILTEETVMEPWLKDHVDFSRVFLAGESAGANIVHDMVVRASASEKPLGDGFKIAGIALIH
PFFGNDEVDEYCSFIFPECEGLDDPRLNPAAHLRLLSSLICRKVMVFTAEKDFLRERSLTYYDALKKSGWNGEVEIMETQGEDHVFHLLE
PNCEKAAXIDEKAS
Predicted Coding Sequence 
ATGGCAGAGTCGAAAGATTTCATAACTXATGTCTATGTTCATCCATCAGATAATTTCAATACTGGAGTTCGATCTAAAGATGTCAATAAC
AATTCAGCTCGCCTTTATCTTCCCAAAATAACCGAAAAAGAACAAAAGTTTCCTCTCCTTATATACATCCATGGTGGAGGTTTTTCAATA
GAATCAGCTTTTTCATCAGGGCATGATAAGTACCTACACTCTATAGTTACTAAGGCCAATGTGGTTGCGATATCCATTGATTATAGACTA
GCTCCAGAGCACCTTTTACCTACGTGTTATGATGATTCTTGGTCCGTCATTAGATGGACTTCTTTACATGTTGAAATGTGTGATCATCTT
ATATTAACAGAAGAAACAGTTATGGAGCCATGGCTCAAGGATCACGTAGATTTCTCACGTGTTTTCTTGGCTGGTGAGAGTGCGGGTGCA
AATATTGTACATGACATGGTTGTTAGAGCAAGTGCTAGTGAAAAGCCACTAGGGGATGGTTTTAAGATTGCTGGAATAGCACTAATCCAT
CCATTTTTCGGTAACGATGAAGTTGATGAGTATTGTTCGTTTATTTTTCCAGAGTGTGAAGGACTTGATGATCCTAGGTTGAATCCAGCA
GCTCATCTTAGGTTACTATCAAGTCTTATTTGTCGAAAGGTTATGGTTTTTACCGCGGAGAAAGATTTTCTAAGAGAGAGGAGTTTGACT
TATTATGATGCATTGAAGAAGAGTGGATGGAATGGTGAGGTTGAGATTATGGAGACACAAGGGGAGGATCATGTTTTTCATTTGCTTGAA
CCAAATTGTGAGAAGGCTGCTXCTATTGATGAAAAGGCTAGTTGA\
Edits in Original Sequence 
ATGGTTTCATTGCCAACAGATGAAATAGCCCATGATTTTCCCCCTTTCTTTCGTGTCTACAAAG(5')ATGGCAGAGTCGAAAGATTTCA
TAACTXATGTCTATGTTCATCCATCAGATAATTTCAATACTGGAGTTCGATCTAAAGATGTCAATAACAATTCAGCTCGCCTTTATCTTC
CCAAAATAACCGAAAAAGAACAAAAGTTTCCTCTCCTTATATACATCCATGGTGGAGGTTTTTCAATAGAATCAGCTTTTTCATCAGGGC
ATGATAAGTACCTACACTCTATAGTTACTAAGGCCAATGTGGTTGCGATATCCATTGATTATAGACTAGCTCCAGAGCACCTTTTACCTA
CGTGTTATGATGATTCTTGGTCCGTCATTAGATGGACTTCTTTACATGTTGAAATGTGTGATCATCTTATATTAACAGAAGAAACAGTTA
TGGAGCCATGGCTCAAGGATCACGTAGATTTCTCACGTGTTTTCTTGGCTGGTGAGAGTGCGGGTGCAAATATTGTACATGACATGGTTG
TTAGAGCAAGTGCTAGTGAAAAGCCACTAGGGGATGGTTTTAAGATTGCTGGAATAGCACTAATCCATCCATTTTTCGGTAACGATGAAG
TTGATGAGTATTGTTCGTTTATTTTTCCAGAGTGTGAAGGACTTGATGATCCTAGGTTGAATCCAGCAGCTCATCTTAGGTTACTATCAA
GTCTTATTTGTCGAAAGGTTATGGTTTTTACCGCGGAGAAAGATTTTCTAAGAGAGAGGAGTTTGACTTATTATGATGCATTGAAGAAGA
GTGGATGGAATGGTGAGGTTGAGATTATGGAGACACAAGGGGAGGATCATGTTTTTCATTTGCTTGAACCAAATTGTGAGAAGGCTGCTX
CTATTGATGAAAAGGCTAGTTGA\(3')GTTTTTTAATGAGAAGATTTGATAAACAATGTTTGGCTGATCTTCATATTTGCAAGCTAGTA
CCATGGTTTAAATTTATCGCCCGCGTCTTGATCATAATACTCGATGAAAGAACACTTAAGTCGTTCTTTTCAAGGCTTAGGCTATTTTTT
TGTTGAGTAGGGTCGTCTTAATACGATTGGTCAAACTTCAATAGAATGTCTTAATGTTGTTATGGTATTCTGTTATTTTATAGAGAAAAA
CGAATATTAAATGTTAATTTGAGGCATTAAGAGATAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan