ESTScan Details for Unigene SGN-U221324

Score 
374
Direction 
Forward
Predicted Peptide Sequence 
GNAPRKAAPIERALPCSLEDLYKGTTKKMKISREVTDATGRPSTTEEILTIDIKPGWKKGTKITFPEKGNEQRGIIPSDLVFIIDEKPHS
VFKRDGNDLVVTQKIPLVEALTGYTAQITTLDGRNLTVPINSIISPNYEEVIKGEGMPIPKEPSRKGNLRVKFNIKFPSKLTSEQKAGIK
RYLT
Predicted Coding Sequence 
GGTAATGCTCCACGAAAGGCCGCTCCTATAGAGCGGGCACTTCCTTGTAGTTTGGAGGATCTATACAAGGGAACCACCAAGAAGATGAAG
ATATCCAGAGAAGTTACTGATGCTACTGGGAGACCCAGTACAACAGAGGAAATTCTAACGATTGATATCAAACCAGGATGGAAGAAGGGG
ACTAAAATAACATTTCCAGAGAAAGGAAACGAGCAACGAGGCATAATTCCATCAGACCTTGTCTTTATAATTGATGAGAAGCCGCATAGC
GTCTTCAAGAGAGATGGAAATGACCTCGTTGTCACCCAGAAAATCCCCTTGGTAGAGGCTCTTACTGGATACACTGCCCAAATAACAACC
CTTGATGGCCGGAATCTAACTGTACCAATTAATTCCATCATTAGTCCAAATTATGAAGAAGTTATCAAAGGAGAAGGTATGCCCATTCCG
AAGGAACCTAGCAGAAAAGGCAACTTGAGAGTAAAGTTTAACATCAAGTTCCCCAGCAAGCTTACTTCTGAGCAGAAAGCTGGCATAAAG
CGGTACTTGACATGA\
Edits in Original Sequence 
(5')GGTAATGCTCCACGAAAGGCCGCTCCTATAGAGCGGGCACTTCCTTGTAGTTTGGAGGATCTATACAAGGGAACCACCAAGAAGAT
GAAGATATCCAGAGAAGTTACTGATGCTACTGGGAGACCCAGTACAACAGAGGAAATTCTAACGATTGATATCAAACCAGGATGGAAGAA
GGGGACTAAAATAACATTTCCAGAGAAAGGAAACGAGCAACGAGGCATAATTCCATCAGACCTTGTCTTTATAATTGATGAGAAGCCGCA
TAGCGTCTTCAAGAGAGATGGAAATGACCTCGTTGTCACCCAGAAAATCCCCTTGGTAGAGGCTCTTACTGGATACACTGCCCAAATAAC
AACCCTTGATGGCCGGAATCTAACTGTACCAATTAATTCCATCATTAGTCCAAATTATGAAGAAGTTATCAAAGGAGAAGGTATGCCCAT
TCCGAAGGAACCTAGCAGAAAAGGCAACTTGAGAGTAAAGTTTAACATCAAGTTCCCCAGCAAGCTTACTTCTGAGCAGAAAGCTGGCAT
AAAGCGGTACTTGACATGA\(3')TGAGTGGACATTAGCTCCTATAGTTTTCCATCAAATGCTACATAAGCTTCACCCCGTCTCGTCTTC
ATCATGCAAAGAAATCTGCACTTCGTTTATTTATTTATTTCTTCTGCAACATTTAAGTCTGTTATTTCAACATCACGGACCTTCTAAACC
GAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan