ESTScan Details for Unigene SGN-U221331

Score 
792
Direction 
Forward
Predicted Peptide Sequence 
MPSSKFEPNDDIFDFVIKKANGLKGIADTSLEIIPNQCIQPEEQRLDKSQIDNQESIPTIDLSNFDDLNIEKSIQEAASKWGFFQIINHG
IPIEVLEDLKEAGHKFFELPAEEKAKYYRENAGADESVLLYWSAIGDKDEKVIEWRDSIKHGCNPQNDSNLWPPQTRNQVLEYQKWATPL
AKKLLEVLLKGLNV
Predicted Coding Sequence 
ATGCCTTCTTCGAAATTTGAACCAAATGATGACATATTTGATTTTGTAATCAAGAAAGCGAATGGACTAAAAGGCATAGCAGACACAAGC
CTTGAAATTATCCCGAATCAATGCATTCAACCAGAAGAACAAAGACTAGACAAATCCCAAATTGACAATCAAGAATCAATCCCGACAATT
GATCTGTCAAATTTTGATGATTTAAACATTGAAAAATCGATTCAAGAAGCAGCAAGCAAATGGGGTTTCTTTCAAATCATCAATCATGGG
ATCCCAATTGAAGTTCTTGAAGATTTGAAAGAAGCAGGACACAAGTTCTTTGAATTGCCAGCTGAAGAAAAAGCTAAGTATTACAGAGAA
AATGCTGGTGCTGATGAATCTGTGTTGTTGTATTGGAGTGCTATTGGTGATAAAGATGAGAAAGTCATAGAGTGGAGGGATAGTATAAAA
CATGGTTGTAATCCACAAAATGATAGCAACCTTTGGCCTCCTCAAACAAGGAATCAAGTCTTGGAGTATCAAAAGTGGGCTACACCACTT
GCTAAAAAGTTATTAGAGGTGCTATTGAAGGGACTCAATGTX\
Edits in Original Sequence 
TTGAATTCGCGTCATAAAGTCTCATATTGAGAGGTAAAATGCTCTCCTAATATACAAAGACAATTATGTATTCAGAAAAATTCGAATACA
GAACATCTGATTAATGATGAAACCCCCCCGGCACCGACTCACACCCTCTCAAATCCACTATAAAAAAAACCCCAAATTGCCTTCTTTCAA
TAGTATACACTTATCAATATTCAACACAA
(5')ATGCCTTCTTCGAAATTTGAACCAAATGATGACATATTTGATTTTGTAATCAAGAAA
GCGAATGGACTAAAAGGCATAGCAGACACAAGCCTTGAAATTATCCCGAATCAATGCATTCAACCAGAAGAACAAAGACTAGACAAATCC
CAAATTGACAATCAAGAATCAATCCCGACAATTGATCTGTCAAATTTTGATGATTTAAACATTGAAAAATCGATTCAAGAAGCAGCAAGC
AAATGGGGTTTCTTTCAAATCATCAATCATGGGATCCCAATTGAAGTTCTTGAAGATTTGAAAGAAGCAGGACACAAGTTCTTTGAATTG
CCAGCTGAAGAAAAAGCTAAGTATTACAGAGAAAATGCTGGTGCTGATGAATCTGTGTTGTTGTATTGGAGTGCTATTGGTGATAAAGAT
GAGAAAGTCATAGAGTGGAGGGATAGTATAAAACATGGTTGTAATCCACAAAATGATAGCAACCTTTGGCCTCCTCAAACAAGGAATCAA
GTCTTGGAGTATCAAAAGTGGGCTACACCACTTGCTAAAAAGTTATTAGAGGTGCTATTGAAGGGACTCAATGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan