ESTScan Details for Unigene SGN-U221391

Score 
904
Direction 
Reverse
Predicted Peptide Sequence 
SNYFGSHIIFFIELARRYRFVIEMEYDPSIEKKAIDDTKAGVKGLVDSGIVEIPRIFIRPSHELAEELNMCRSTLQVPVVDLSGIEVEDR
RKKIVDEIRDASEKWGFFQLINHGIPSSVLEGMIDGTRKFHEQDVEVKKEYYSSDPRRGVRFESNLQLLTTKGRNATWKDTLYISKSVSE
PEEIPEVCRKILVEYKNHVIILGDILLGLLSEALGLKPDHLKAADCNKGLMLACHYYPACPQPELTLGTGKHTDPVFLTVLLQDQSGGLQ
VMRDNQWADVEPIEHGLVINIGDLLQIVSNDKFVSAIHRVVANKVGPRISAASFFTGSSTPPKIYGPIKELISEENPALYKDFLAADYTA
KYFSQPVNTLDLFRLEERPSTTMSEFVIAVQ
Predicted Coding Sequence 
XXGTCCAATTATTTTGGAAGTCATATCATTTTTTTCATTGAACTAGCTAGACGCTATCGATTCGTAATTGAGATGGAATATGATCCATCG
ATTGAGAAAAAGGCTATTGATGATACAAAGGCCGGTGTTAAAGGACTAGTTGATTCAGGAATAGTCGAGATTCCAAGAATTTTCATTAGG
CCATCTCATGAACTTGCTGAGGAGTTGAATATGTGCAGGTCAACTCTACAGGTTCCAGTGGTGGATCTAAGTGGCATAGAAGTTGAAGAT
CGACGTAAGAAGATTGTCGATGAAATAAGGGATGCATCTGAGAAATGGGGATTTTTTCAACTGATAAATCATGGGATTCCTTCAAGTGTT
TTGGAAGGAATGATTGATGGAACTCGTAAATTTCATGAACAAGATGTCGAAGTGAAGAAAGAGTACTATTCGTCTGATCCAAGACGAGGA
GTTAGATTTGAGAGTAATCTTCAACTGTTGACAACAAAAGGTAGAAATGCAACCTGGAAGGATACATTGTATATCTCTAAGTCAGTTTCT
GAACCTGAAGAAATACCAGAAGTTTGCAGGAAAATATTGGTTGAGTACAAAAATCATGTTATAATACTAGGGGACATTCTTCTTGGCTTA
CTATCAGAAGCTCTTGGGCTAAAACCTGACCACTTGAAAGCCGCGGATTGTAACAAAGGACTAATGTTGGCATGTCATTACTACCCGGCA
TGTCCACAGCCAGAGCTGACTCTTGGTACCGGTAAGCATACAGATCCTGTTTTCCTTACCGTTCTGCTTCAAGATCAGAGCGGTGGGCTC
CAAGTCATGCGTGATAACCAATGGGCTGATGTTGAACCGATTGAACATGGTTTGGTTATTAATATTGGTGACCTTCTTCAGATCGTATCA
AATGACAAGTTTGTTAGTGCAATTCATAGAGTTGTAGCAAATAAGGTAGGACCAAGGATTTCAGCGGCAAGCTTCTTCACTGGAAGTTCT
ACACCTCCGAAGATATATGGTCCAATCAAAGAGCTCATATCTGAAGAAAACCCCGCACTATATAAAGACTTTCTAGCAGCTGATTATACT
GCTAAGTATTTCTCCCAGCCTGTTAATACTCTTGATCTTTTCAGACTTGAAGAGAGACCGAGCACCACAATGTCAGAGTTTGTGATTGCT
GTACAATAA\
Edits in Original Sequence 
(5')XXGTCCAATTATTTTGGAAGTCATATCATTTTTTTCATTGAACTAGCTAGACGCTATCGATTCGTAATTGAGATGGAATATGATCC
ATCGATTGAGAAAAAGGCTATTGATGATACAAAGGCCGGTGTTAAAGGACTAGTTGATTCAGGAATAGTCGAGATTCCAAGAATTTTCAT
TAGGCCATCTCATGAACTTGCTGAGGAGTTGAATATGTGCAGGTCAACTCTACAGGTTCCAGTGGTGGATCTAAGTGGCATAGAAGTTGA
AGATCGACGTAAGAAGATTGTCGATGAAATAAGGGATGCATCTGAGAAATGGGGATTTTTTCAACTGATAAATCATGGGATTCCTTCAAG
TGTTTTGGAAGGAATGATTGATGGAACTCGTAAATTTCATGAACAAGATGTCGAAGTGAAGAAAGAGTACTATTCGTCTGATCCAAGACG
AGGAGTTAGATTTGAGAGTAATCTTCAACTGTTGACAACAAAAGGTAGAAATGCAACCTGGAAGGATACATTGTATATCTCTAAGTCAGT
TTCTGAACCTGAAGAAATACCAGAAGTTTGCAGGAAAATATTGGTTGAGTACAAAAATCATGTTATAATACTAGGGGACATTCTTCTTGG
CTTACTATCAGAAGCTCTTGGGCTAAAACCTGACCACTTGAAAGCCGCGGATTGTAACAAAGGACTAATGTTGGCATGTCATTACTACCC
GGCATGTCCACAGCCAGAGCTGACTCTTGGTACCGGTAAGCATACAGATCCTGTTTTCCTTACCGTTCTGCTTCAAGATCAGAGCGGTGG
GCTCCAAGTCATGCGTGATAACCAATGGGCTGATGTTGAACCGATTGAACATGGTTTGGTTATTAATATTGGTGACCTTCTTCAGATCGT
ATCAAATGACAAGTTTGTTAGTGCAATTCATAGAGTTGTAGCAAATAAGGTAGGACCAAGGATTTCAGCGGCAAGCTTCTTCACTGGAAG
TTCTACACCTCCGAAGATATATGGTCCAATCAAAGAGCTCATATCTGAAGAAAACCCCGCACTATATAAAGACTTTCTAGCAGCTGATTA
TACTGCTAAGTATTTCTCCCAGCCTGTTAATACTCTTGATCTTTTCAGACTgTGAAGAGAGACCGAGCACCACAATGTCAGAGTTTGTGA
TTcGCTGTACAATAA\(3')ATGTCGTCTTTCGTATTCTGCTCTTTATTTTCAAATAAAAAGGGATCTGTTCCATAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan