ESTScan Details for Unigene SGN-U221405

Score 
1469
Direction 
Forward
Predicted Peptide Sequence 
MAILGLSNPAELASSPSSSLAFSHGCILPSFLNNASSPVFAGKVFAGLNVSAFQXSFTPMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVD
FYAINTDAQALVQSAAENPLQIGELLTRGLGTGGNPLLGEQAAEESKEAIANSLKGSDMVFITAGMGGGTGSGAAPVVAQIAKEAGYLTV
GVVTYPFSFEGRKRSVQALEAIEKLQRNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMK
DSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDERYNGEIHVT
IIATGFTQSFQKTLLSDPRGAKLIEKGAGIKENMASPVTLRSSNTPSTTSXDTYSKAVLLAP
Predicted Coding Sequence 
ATGGCGATTTTAGGGCTCTCAAATCCAGCAGAATTAGCTTCTTCTCCGTCTTCTTCCTTAGCTTTTTCTCATGGTTGCATTCTTCCTTCA
TTCCTAAACAATGCTTCTTCACCGGTGTTCGCCGGAAAAGTTTTTGCCGGCCTCAACGTTTCAGCATTTCAAGXTTCATTCACTCCGATG
GATTCTGCTAAAATTAAGGTCGTCGGCGTCGGTGGAGGTGGAAACAATGCCGTTAACCGTATGATTGGTAGTGGTTTACAGGGTGTTGAC
TTCTATGCTATAAACACGGATGCTCAAGCACTGGTACAGTCTGCTGCCGAGAACCCACTTCAAATTGGAGAACTTCTGACTCGTGGGCTT
GGTACTGGTGGCAATCCTCTTTTAGGGGAACAGGCAGCAGAGGAGTCAAAGGAAGCTATTGCAAATTCTCTGAAAGGTTCAGATATGGTT
TTCATAACAGCAGGAATGGGTGGAGGTACAGGATCTGGTGCGGCTCCTGTTGTGGCTCAAATAGCAAAAGAAGCAGGTTATTTGACTGTT
GGTGTTGTTACATATCCATTCAGCTTTGAAGGACGTAAAAGATCTGTGCAGGCTCTGGAAGCAATTGAAAAACTTCAGAGAAATGTTGAC
ACACTTATAGTAATTCCCAATGATCGTCTGCTAGATATTGCCGATGAGCAGACACCACTTCAAGATGCTTTTCTTCTTGCGGATGATGTA
TTACGTCAAGGTGTCCAAGGAATATCTGATATAATCACTATTCCTGGGCTTGTGAATGTGGATTTTGCCGATGTAAAGGCAGTGATGAAA
GACTCTGGAACTGCAATGCTCGGAGTGGGTGTTTCATCAAGTAAGAACCGAGCTGAAGAAGCAGCCGAACAAGCAACTCTGGCCCCTCTA
ATTGGGTCGTCAATTCAATCTGCAACTGGGGTAGTATATAACATTACAGGAGGAAAAGACATAACTTTGCAAGAAGTGAATAGGGTGTCC
CAGGTTGTTACCAGTCTAGCTGATCCCTCTGCTAACATCATATTTGGTGCTGTTGTTGATGAGCGTTACAATGGTGAAATACACGTGACA
ATAATTGCAACTGGTTTCACCCAGTCGTTTCAGAAGACACTTCTATCTGATCCACGGGGAGCAAAGCTAATCGAGAAGGGGGCAGGAATC
AAAGAAAACATGGCATCACCTGTTACCCTGAGATCATCAAACACACCTTCAACAACCTCACXGGACACCTACTCGAAGGCTGTTCTTTTA
GCTCCT\
Edits in Original Sequence 
TACAGAATTTTGGGTAAACTAAAATACAGAGAAAGCAACA(5')ATGGCGATTTTAGGGCTCTCAAATCCAGCAGAATTAGCTTCTTCTC
CGTCTTCTTCCTTAGCTTTTTCTCATaGGTTGCATTCTTCCTTCATTCCTAAACAATGCTTCTTCACCGGTGTTCGCCGGAAAAGTTTTT
GCCGGCCTCAACGTTTCAGCATTTCAAGXTTCATTCACTCCGATGGATTCTGCTAAAATTAAGGTCGTCGGCGTCGGTGGAGGTGGAAAC
AATGCCGTTAACCGTATGATTGGTAGTGGTTTACAGGGTGTTGACTTCTATGCTATAAACACGGATGCTCAAGCACTGGTACAGTCTGCT
GCCGAGAACCCACTTCAAATTGGAGAACTTCTGACTCGTGGGCTTGGTACTGGTGGCAATCCTCTTTTAGGGGAACAGGCAGCAGAGGAG
TCAAAGGAAGCTATTGCAAATTCTCTGAAAGGTTCAGATATGGTTTTCATAACAGCAGGAATGGGTGGAGGTACAGGATCTGGTGCGGCT
CCTGTTGTGGCTCAAATAGCAAAAGAAGCAGGTTATTTGACTGTTGGTGTTGTTACATATCCATTCAGCTTTGAAGGACGTAAAAGATCT
GTGCAGGCTCTGGAAGCAATTGAAAAACTTCAGAGAAATGTTGACACACTTATAGTAATTCCCAATGATCGTCTGCTAGATATTGCCGAT
GAGCAGACACCACTTCAAGATGCTTTTCTTCTTGCGGATGATGTATTACGTCAAGGTGTCCAAGGAATATCTGATATAATCACTATTCCT
GGGCTTGTGAATGTGGATTTTGCCGATGTAAAGGCAGTGATGAAAGACTCTGGAACTGCAATGCTCGGAGTGGGTGTTTCATCAAGTAAG
AACCGAGCTGAAGAAGCAGCCGAACAAGCAACTCTGGCCCCTCTAATTGGGTCGTCAATTCAATCTGCAACTGGGGTAGTATATAACATT
ACAGGAGGAAAAGACATAACTTTGCAAGAAGTGAATAGGGTGTCCCAGGTTGTTACCAGTCTAGCTGATCCCTCTGCTAACATCATATTT
GGTGCTGTTGTTGATGAGCGTTACAATGGTGAAATACACGTGACAATAATTGCAACTGGTTTCACCCAGTCGTTTCAGAAGACACTTCTA
TCTGATCCACGGGGAGCAAAGCTAATCGAGAAGGGGGCAGGAATCAAAGAAAACATGGCATCACCTGTTACCCTGAGATCATCAAACACA
CCTTCAACAACCTCACXGGACACCTACTCGAAGGCTGTTCTTTTAGCTCCT\(3')TCATATTGTTTTATTTTACAGCTTCATTACTCTC
CTTTTTAGTTTCTTCCTTTGTAGTTAACATGTTTTGCTGAAGGGAAACTGATTGGTGTTTGCATGTGGCTGTAGAGATAGTGATTATTCT
TTATCAGATGCATATTCAGCTATGCTCTCTTGTGACATGCACGTTTTTACGCATGTAAAAATATTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan