ESTScan Details for Unigene SGN-U221470

Score 
1069
Direction 
Forward
Predicted Peptide Sequence 
KPEXLLTTISSLKKKKETIHTNSQKTKIYQQFAFSGYVGELLMGEHLALCVDRLITPESLPSMQGSEDAGSSEGDSCSHTVGQSACGTAN
KKDEEPEDGGEDEPLLQTVECRICQEEDSPKNLEIPCSCNGSLKYAHRKCVQRWCNEKGDIICEICHQPYQPGYTAPPPPSLSEDIAIDM
SGGWTVAGTQLDLHDPRLLAMAAAERHLLEADYDEYADSSASGAAFCRSAALILMALLLLRHAVTIGNGDGDDDDVSAFFSLFLLRAAGF
LLPCYIMAWAISIMQRRRQRQEAAALAAAEVAFMLQAGQHRGLHVTIAPGPAQAAEPSAAPANPTTHVATPTGQVTTPPPELV
Predicted Coding Sequence 
AAACCGGAAGAXCTTCTTACAACTATTTCTTCTCTCAAGAAAAAAAAGGAAACTATTCATACAAATTCTCAGAAAACCAAAATCTATCAA
CAATTTGCATTTTCAGGATACGTGGGTGAATTGCTAATGGGAGAACACTTGGCTCTGTGTGTTGATCGTCTTATCACACCTGAATCTTTG
CCCTCTATGCAAGGGTCAGAGGATGCAGGATCCTCCGAGGGGGATTCTTGCTCTCACACAGTAGGTCAATCTGCCTGTGGCACTGCTAAT
AAAAAGGATGAAGAACCAGAAGATGGAGGTGAAGATGAGCCATTGCTTCAAACTGTGGAATGCCGAATTTGCCAGGAAGAAGATAGCCCG
AAGAATTTGGAGATTCCATGTAGCTGCAATGGAAGCTTAAAGTATGCTCATAGGAAATGCGTTCAGCGGTGGTGCAACGAGAAGGGTGAT
ATAATATGCGAGATTTGCCATCAGCCTTACCAACCTGGATATACTGCCCCTCCACCGCCTTCTCTCTCCGAAGATATTGCCATTGACATG
AGTGGGGGCTGGACGGTAGCTGGTACTCAGCTCGACTTACATGATCCTCGGCTTCTTGCAATGGCGGCTGCAGAACGCCATCTCTTGGAG
GCTGACTATGATGAATATGCTGATTCAAGTGCTAGTGGAGCTGCATTTTGCCGTTCTGCTGCTTTAATTTTAATGGCCCTTTTATTATTG
AGGCATGCTGTGACCATCGGAAATGGTGATGGGGATGATGATGACGTTTCTGCTTTTTTCTCGCTTTTCTTACTCCGTGCTGCTGGTTTT
CTTCTACCTTGCTACATCATGGCTTGGGCTATAAGTATCATGCAGCGTCGAAGGCAAAGACAGGAGGCTGCAGCACTAGCGGCAGCAGAG
GTTGCTTTCATGCTGCAAGCAGGGCAACATAGGGGCTTGCATGTAACAATAGCACCAGGACCTGCACAGGCAGCAGAACCTTCAGCAGCA
CCAGCAAACCCAACTACCCATGTTGCAACACCAACTGGCCAGGTCACAACTCCTCCTCCGGAGCTAGTATAA\
Edits in Original Sequence 
(5')AAACCGGAAGAXCTTCTTACAACTATTTCTTCTCTCAAGAAAAAAAAGGAAACTATTCATACAAATTCTCAGAAAACCAAAATCTA
TCAACAATTTGCATTTTCAGGATACGTGGGTGAATTGCTAATGGGAGAACACTTGGCTCTGTGTGTTGATCGTCTTATCACACCTGAATC
TTTGCCCTCTATGCAAGGGTCAGAGGATGCAGGATCCTCCGAGGGGGATTCTTGCTCTCACACAGTAGGTCAATCTGCCTGTGGCACTGC
TAATAAAAAGGATGAAGAACCAGAAGATGGAGGTGAAGATGAGCCATTGCTTCAAACTGTGGAATGCCGAATTTGCCAGGAAGAAGATAG
CCCGAAGAATTTGGAGATTCCATGTAGCTGCAATGGAAGCTTAAAGTATGCTCATAGGAAATGCGTTCAGCGGTGGTGCAACGAGAAGGG
TGATATAATATGCGAGATTTGCCATCAGCCTTACCAACCTGGATATACTGCCCCTCCACCGCCTTCTCTCTCCGAAGATATTGCCATTGA
CATGAGTGGGGGCTGGACGGTAGCTGGTACTCAGCTCGACTTACATGATCCTCGGCTTCTTGCAATGGCGGCTGCAGAACGCCATCTCTT
GGAGGCTGACTATGATGAATATGCTGATTCAAGTGCTAGTGGAGCTGCATTTTGCCGTTCTGCTGCTTTAATTTTAATGGCCCTTTTATT
ATTGAGGCATGCTGTGACCATCGGAAATGGTGATGGGGATGATGATGACGTTTCTGCTTTTTTCTCGCTTTTCTTACTCCGTGCTGCTGG
TTTTCTTCTACCTTGCTACATCATGGCTTGGGCTATAAGTATCATGCAGCGTCGAAGGCAAAGACAGGAGGCTGCAGCACTAGCGGCAGC
AGAGGTTGCTTTCATGCTGCAAGCAGGGCAACATAGGGGCTTGCATGTAACAATAGCACCAGGACCTGCACAGGCAGCAGAACCTTCAGC
AGCACCAGCAAACCCAACTACCCATGTTGCAACACCAACTGGCCAGGTCACAACTCCTCCTCCGGAGCTAGTATAA\(3')ATGGCTTTG
CTCAGCTGGCATGTTAAACGCTGTTGCTGATGATGACATTGTACTTTGTAAGTTGCAAAAGCTAAGAGAACAGAGGTTCTTTTTTTACTG
TCGATGTATTAGTCGTATCTTAGCCCTGCCAAATACAGAGGCTGAAATTGTTCCCTTTTGTACAATATTTACATTAATGCTTGAACATGT
AAAACATGTAAAAAACCATAGCAGCTAACTTATCTGCTTTGAAATTGGAGATTATGTTCACATCAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan