ESTScan Details for Unigene SGN-U221542

Score 
-51
Direction 
Forward
Predicted Peptide Sequence 
MSFDDDDDHPFFHRKNKYDLNSKIMITAIISLSIVIFFVTLLHIYAEVRPQRQARRRAELQRVSFITSSALHVEPPKTGLDPSVIDSLPV
FILKQNDINQNNTIECTVCLSALEDGERVRNLPNCKHVFHAECIDKWFGSHSTCPICRTEAEPRLLQPGHVEGGGRSYHALRPPIEGGXS
INVEDCGLTQDAKINGSSSRLSX
Predicted Coding Sequence 
ATGAGTTTTGATGATGATGATGATCATCCATTTTTTCATAGAAAAAACAAATATGATCTTAATAGCAAGATCATGATAACAGCCATAATT
TCATTATCTATAGTTATTTTCTTCGTTACTCTCCTCCATATTTACGCXGAGGTGCGTCCTCAACGCCAGGCTAGACGTAGGGCGGAGCTT
CAGCGCGTCAGCTTCATCACCAGCTCCGCCCTACATGTCGAGCCCCCTAAGACGGGGCTTGACCCGTCCGTGATAGACTCGCTACCGGTA
TTTATTCTCAAACAGAATGATATTAATCAAAATAATACAATTGAGTGCACGGTTTGTTTGAGTGCTCTTGAAGATGGAGAAAGGGTTAGA
AATTTGCCTAATTGCAAACATGTGTTTCATGCTGAGTGTATTGACAAGTGGTTTGGGTCACACTCAACGTGCCCGATTTGTCGGACTGAG
GCTGAGCCCCGGTTGTTACAACCGGGGCATGTGGAGGGGGGTGGTAGGTCCTACCACGCCCTCAGGCCACCAATTGAGGGTGGCGNATCG
ATAAATGTGGAAGATTGTGGATTGACACAAGATGCTAAAATTAATGGATCAAGTTCGAGATTAAGCTXX\
Edits in Original Sequence 
AAAACTCCACAACATCACGACAACA(5')ATGAGTTTTGATGATGATGATGATCATCCATTTTTTCATAGAAAAAACAAATATGATCTTA
ATAGCAAGATCATGATAACAGCCATAATTTCATTATCTATAGTTATTTTCTTCGTTACTCTCCTCCATATTTACGCXGAGGTGCGTCCTC
AgACGCCAGGCTAGACGTAGGGCGGAGCTTCAGCGCGTCAGCTTCATCACCAGCTCCGCCCTACATGTCGAGCCCCCTAAGACGGGGCTT
GACCCGTCCGTGATAGACTCGCTACCGGTATTTATTCTCAAACAGAATGATATTAATCAAAATAATACAATTGAGTGCACGGTTTGTTTG
AGTGCTCTTGAAGATGGAGAAAGGGTTAGAAATTTGCCTAATTGCAAACATGTGTTTCATGCTGAGTGTATTGACAAGTGGTTTGGGTCA
CACTCAACGTGCCCGATTTGTCGGACTGAGGCTGAGCCCCGGTTGTTACAACCGGGGCATGTGGAGGGGGGTGGTAGGTCCTACCACGCC
CTCAGcGCCACCAATTGAGGGTGGCGNATCGATAAATGTGGAAGATTGTGGATTGACACAAGATGCTAAAATTAATGGATCAAGTTCGAG
ATTAAGCTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan