ESTScan Details for Unigene SGN-U221567

Score 
603
Direction 
Forward
Predicted Peptide Sequence 
IIHRDVKAANILLDDDCEAVVGDFGLAKLLDHRDSHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQK
GVMLDWVKKIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKMSEVEECSKETDLQRNGKLHKEQNLRDAEPMSSRLQK
DIXDLTDDSSLLVQAMELSGPR
Predicted Coding Sequence 
XXGATTATCCACAGGGATGTGAAGGCAGCAAATATATTGCTCGACGATGACTGTGAGGCTGTCGTGGGAGATTTTGGATTGGCAAAGCTA
TTGGATCATCGCGATTCACATGTCACAACTGCAGTTAGGGGAACAGTAGGACATATAGCTCCTGAGTATCTCTCTACAGGACAGTCCTCT
GATAAAACAGATGTTTTCGGGTTTGGAATTCTCCTGCTAGAGTTGATATCTGGCCAGAGAGCTCTTGAATTTGGTAAAGCAGCAAATCAG
AAAGGTGTTATGCTTGATTGGGTGAAGAAGATTCACCTGGAGAAAAAGCTTGATTTGCTGGTGAGCAAGGACTTAAAGGACAAATATGAT
CGGATCGAGCTTGAGGAAATGGTACAAGTAGCTCTAATATGCACTCAGTATCACCCTAGTCATAGACCAAAAATGTCAGAAGTGGAAGAA
TGCTCGAAGGAGACGGACTTGCAGAGAAATGGGAAGCTTCACAAAGAGCAGAATCTACGCGATGCAGAGCCAATGAGTTCTCGTCTTCAG
AAAGATATTXCTGATCTTACTGATGATTCTTCATTGCTTGTTCAAGCAATGGAATTATCAGGACCAAGGTGA\
Edits in Original Sequence 
(5')XXGATTATCCACAGGGATGTGAAGGCAGCAAATATATTGCTCGACGATGACTGTGAGGCTGTCGTGGGAGATTTTGGATTGGCAAA
GCTATTGGATCATCGCGATTCACATGTCACAACTGCAGTTAGGGGAACAGTAGGACATATAGCTCCTGAGTATCTCTCTACAGGACAGTC
CTCTGATAAAACAGATGTTTTCGGGTTTGGAATTCTCCTGCTAGAGTTGATATCTGGCCAGAGAGCTCTTGAATTTGGTAAAGCAGCAAA
TCAGAAAGGTGTTATGCTTGATTGGGTGAAGAAGATTCACCTGGAGAAAAAGCTTGATTTGCTGGTGAGCAAGGACTTAAAGGACAAATA
TGATCGGATCGAGCTTGAGGAAATGGTACAAGTAGCTCTAATATGCACTCAGTATCACCCTAGTCATAGACCAAAAATGTCAGAAGTGGt
AAGAATGCTCGAAGGAGACGGACTTGCAGAGAAATGGGAAGCTTCACAAAGAGCAGAATCTACGCGATGCAGAGCCAATGAGTTCTCGTC
TTCAGAAAGATATTXCTGATCTTACTGATGATTCTTCATTGCTTGTTCAAGCAATGGAATTATCAGGACCAAGGTGA\(3')TGTAGATT
ATAAAAGATAGATAATTAGATGAAACAAAAAAAGGGCATCTGAGATAGAATGCTCAAGTAATATTGCTGTATGTTATTGAGCTTGTTTTT
TTGTTTTCTTTTATTAACCGAGAAGTCCTCGAGGGTCAATAGTGCACTGTTCATAACTCAGTGGATGATAGAACCGCCCCTTTACTCTTC
TCCAGTTATATACCAGACGCGGTAGGGTTCAATTGAGCTTGTATATATATGATTATATGGAAGCTGCATAAAGGAATGAGATATGTTCTG
ACTGTATAGGAAAAAGACTGATGTATGCACAACTGACCCCTCACCCCTTTTTTTTCCCTCTTCATGTTTTGAGTGATAATTTTTCTAGGA
TGTGAAATTGTAACTTTGAGCTTGTAAGAATAATATTGTTGAAATTCAATTTCAGCTTATAAATAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan