ESTScan Details for Unigene SGN-U221653

Score 
301
Direction 
Forward
Predicted Peptide Sequence 
MEKTLSLVLILPLLIMLLLVGTHAKIIIESPAPQPQPPNTLPMNGTTPGSLHPQDCLPKCTYRCSNTQYRKPCMFFCQKCCAKCLCVPAG
TYGNKQFCPCYNNWKTKRGGPKCP
Predicted Coding Sequence 
ATGGAGAAGACACTTAGCTTAGTGCTAATACTCCCTCTTCTAATAATGCTTCTTCTTGTTGGAACTCATGCAAAAATAATAATAGAATCT
CCAGCACCTCAGCCACAACCTCCTAACACTTTACCAATGAATGGTACTACTCCTGGTAGTCTCCATCCTCAAGATTGTTTACCAAAGTGC
ACATATAGATGCTCAAATACACAATATAGGAAGCCATGTATGTTCTTTTGCCAAAAATGTTGTGCAAAGTGTCTCTGTGTTCCTGCTGGG
ACTTATGGGAACAAACAATTTTGCCCTTGTTACAATAATTGGAAGACTAAGAGAGGAGGCCCAAAATGCCCTTAA\
Edits in Original Sequence 
TCGTGCCTTTCTCTCTTTTGTTCAATTAATATATCAAGAAAACAACAAA(5')ATGGAGAAGACACTTAGCTTAGTGCTAATACTCCCTC
TTCTAATAATGCTTCTTCTTGTTGGAACTCATGCAAAAATAATAATAGAATCTCCAGCACCTCAGCCACAACCTCCTAACACTTTACCAA
TGAATGGTACTACTCCTGGTAGTCTCCATCCTCAAGATTGTTTACCAAAGTGCACATATAGATGCTCAAATACACAATATAGGAAGCCAT
GTATGTTCTTTTGCCAAAAATGTTGTGCAAAGTGTCTCTGTGTTCCTGCTGGGACTTATGGGAACAAACAATTTTGCCCTTGTTACAATA
ATTGGAAGACTAAGAGAGGAGGCCCAAAATGCCCTTAA\(3')TCATATATGCACTGACGATAAAAAGAAGTTTTATATTACGAGTTTAC
TAAATTAATTATTTGTTATAAAATAATGTTTGTAGTATTTTTAAGTTACGAGTTTCGCTTATTATAAATCATCTCATGTAATTATGTTTT
AAGGGATTGAATAGAATAAATTATTTTATTTTATCATTATATAAATTATTATTTTTTGGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan