ESTScan Details for Unigene SGN-U221670

Score 
944
Direction 
Forward
Predicted Peptide Sequence 
AKINEDQVRKAVKALLKWKKLQSKKTLELQNLNSLSDEEENEEDEVVDDNFIYLQLTLKKIPPKELTTPHKITLPNPFFHPLESFANICL
IIDDRPRKSHNSKTKLDVETVQKKLKSEGISITKVLKFTKLKSEYKSFDAKLDLYGSYELFLADKRVMNLLPGLLGKQFYKKKRKVPVPV
DLRGNSNWKEEIERACSSTLLCLGSGTCSVLKIGRGGMENGEVMENVLAAIDGIVQFVPKKLNGVRAFHLKFSDSLALPVYEDFPDQSSK
Q
Predicted Coding Sequence 
XTGGCGAAAATCAATGAAGACCAAGTTCGCAAAGCAGTGAAAGCTCTTCTCAAATGGAAAAAGCTTCAATCCAAGAAAACCCTTGAACTG
CAAAACCTCAATTCACTATCAGATGAAGAAGAAAACGAAGAAGATGAAGTAGTAGATGATAATTTCATCTATCTTCAATTAACTCTGAAG
AAAATCCCACCAAAAGAACTCACAACCCCTCACAAAATCACCCTCCCCAACCCCTTTTTCCACCCACTTGAATCTTTCGCTAATATTTGT
CTCATCATTGACGACAGACCCAGAAAATCCCACAACTCAAAAACCAAACTTGATGTTGAAACAGTGCAGAAAAAGCTGAAATCTGAAGGA
ATTTCAATTACGAAAGTTTTGAAGTTTACCAAGTTGAAGTCTGAGTACAAATCTTTTGATGCGAAGCTGGATTTGTACGGTTCATATGAA
CTGTTTTTGGCTGATAAAAGAGTGATGAATTTGCTTCCGGGTTTATTAGGTAAGCAGTTTTACAAGAAGAAGAGGAAAGTACCTGTGCCA
GTTGATTTGAGGGGGAATAGTAATTGGAAGGAGGAGATAGAAAGAGCGTGTTCGTCGACTTTGTTGTGTTTAGGGAGTGGAACATGTAGT
GTTTTGAAGATTGGGAGAGGAGGGATGGAGAATGGTGAAGTTATGGAGAATGTATTAGCTGCCATTGATGGAATTGTTCAGTTTGTTCCT
AAGAAATTGAATGGTGTTAGAGCTTTTCATTTGAAGTTTAGTGATTCATTGGCATTGCCTGTTTATGAGGATTTCCCTGATCAAAGTTCA
AAACAATGA\
Edits in Original Sequence 
(5')XTGGCGAAAATCAATGAAGACCAAGTTCGCAAAGCAGTGAAAGCTCTTCTCAAATGGAAAAAGCTTCAATCCAAGAAAACCCTTGA
ACTGCAAAACCTCAATTCACTATCAGATGAAGAAGAAAACGAAGAAGATGAAGTAGTAGATGATAATTTCATCTATCTTCAATTAACTCT
GAAGAAAATCCCACCAAAAGAACTCACAACCCCTCACAAAATCACCCTCCCCAACCCCTTTTTCCACCCACTTGAATCTTTCGCTAATAT
TTGTCTCATCATTGACGACAGACCCAGAAAATCCCACAACTCAAAAACCAAACTTGATGTTGAAACAGTGCAGAAAAAGCTGAAATCTGA
AGGAATTTCAATTACGAAAGTTTTGAAGTTTACCAAGTTGAAGTCTGAGTACAAATCTTTTGATGCGAAGCTGGATTTGTACGGTTCATA
TGAACTGTTTTTGGCTGATAAAAGAGTGATGAATTTGCTTCCGGGTTTATTAGGTAAGCAGTTTTACAAGAAGAAGAGGAAAGTACCTGT
GCCAGTTGATTTGAGGGGGAATAGTAATTGGAAGGAGGAGATAGAAAGAGCGTGTTCGTCGACTTTGTTGTGTTTAGGGAGTGGAACATG
TAGTGTTTTGAAGATTGGGAGAGGAGGGATGGAGAATGGTGAAGTTATGGAGAATGTATTAGCTGCCATTGATGGAATTGTTCAGTTTGT
TCCTAAGAAATTGAATGGTGTTAGAGCTTTTCATTTGAAGTTTAGTGATTCATTGGCATTGCCTGTTTATGAGGATTTCCCTGATCAAAG
TTCAAAACAATGA\(3')GAAGAAAAAGAAGTAGAGAAAGTGAGATCTTGCTCTTCGAAAGATTTTTCGAGCTAGAAGTTCGCGTAAGGA
GTTGACGCATAGGTAAATTTGGATGAAGTGTTTCCATTTTTGTTCTTACTAGATAGTGAATACAACAATCTGTTCTTGTTCCTTTTATTG
TCTGATTTGATCTAGTGTTGTTTCAAGTGGAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan