ESTScan Details for Unigene SGN-U221775

Score 
305
Direction 
Reverse
Predicted Peptide Sequence 
MFYKAGDPTLVNPCTWFHVTCDSDNNVIRLDLGNSNISGTLGPELGELKNLQYLELYSNNLEGEIPKEFGDLENLISMDLYGNKFEGNIP
QSFAKLKSLRFLRLNDNELTGSIPRELTTLPNLKVFDVSNNNLCGTIPADGPFGSFPMEGFAHNRLNGPELKGLVPYDFGCKEVEV
Predicted Coding Sequence 
ATGTTCTACAAAGCTGGXGACCCTACACTTGTAAATCCTTGTACATGGTTTCATGTTACCTGTGACTCAGATAATAATGTTATTCGCCTG
GATTTGGGCAATTCTAATATTTCTGGAACATTAGGACCAGAACTTGGTGAACTCAAGAATCTACAGTATCTGGAACTTTATAGTAATAAC
TTAGAAGGGGAAATCCCAAAGGAATTTGGTGATCTGGAAAATCTTATTAGCATGGACCTATATGGCAACAAATTTGAAGGCAACATTCCC
CAGTCTTTTGCTAAACTAAAGTCTCTTAGATTTTTACGGTTAAACGACAATGAACTAACTGGTTCGATTCCAAGGGAACTTACGACACTC
CCCAACCTTAAAGTATTTGATGTTTCTAACAACAATCTTTGTGGAACAATCCCTGCTGATGGACCCTTTGGAAGCTTTCCTATGGAAGGT
TTTGCACACAACAGACTCAATGGACCTGAATTGAAAGGACTAGTGCCCTATGACTTTGGATGCAAAGAAGTTGAAGTATAG\
Edits in Original Sequence 
AGAATTCGGCACGAGCTTCCATTCTTTCTCCATTTCTTCAATGGCTTTTCCTTCCTCATTTCTCTTCTTCTTCCAAATCATTCTTTGTAT
TCCCTCTGCCTTCTCCACAAATTCTGAAGGGACTGCTTTGCATTCTTTGAGAACCAAACTTTCTGACCCAAAAA
(5')ATGTTCTACAAA
GCTGGXGACCCTACACTTGTAAATCCTTGTACATGGTTTCATGTTACCTGTGACTCAGATAATAATGTTATTCGCCTGGATTTGGGCAAT
TCTAATATTTCTGGAACATTAGGACCAGAACTTGGTGAACTCAAGAATCTACAGTATCTGGAACTTTATAGTAATAACTTAGAAGGGGAA
ATCCCAAAGGAATTTGGTGATCTGGAAAATCTTATTAGCATGGACCTATATGGCAACAAATTTGAAGGCAACATTCCCCAGTCTTTTGCT
AAACTAAAGTCTCTTAGATTTTTACGGTTAAACGACAATGAACTAACTGGTTCGATTCCAAGGGAACTTACGACACTCCCCAACCTTAAA
GTATTTGATGTTTCTAACAACAATCTTTGTGGAACAATCCCTGCTGATGGACCCTTTGGAAGCTTTCCTATGGAAGGTTTTGCACACAAC
AGACTCAATGGACCTGAATTGAAAGGACTAGTGCCCTATGACTTTGGATGCAAAGAAGTTGAAGTATAG\(3')TTTGACAACAGCCTTC
ACAAGGTTGTGGTTGCTATTATATCTTATGTATTGTATATGTAGAGTTTGACAGTGTTACTGAAATTAAAAATCTCAAGTCGAATGCACT
TCATGATACATAACGTTCTTTAAATTCATCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan