ESTScan Details for Unigene SGN-U221884

Score 
524
Direction 
Forward
Predicted Peptide Sequence 
MQRTRDQRSRSSRPITIHGLAQSGDVVAFKKLLNDNPFLLNERNPVMVQTPLHVATGYNNVEILKFLLSWPGPEKVELEAKNMYGETPLH
MAAKNGCNETAKMLLAHGALVEARANNGMTPLHLAVWHSLRAEDYSTVKTLLEYNADCSAEDDEGKTPIHHLSQGPGNEKLRELLHQYLD
EX
Predicted Coding Sequence 
ATGCAGAGGACAAGGGATCAACGTTCAAGATCTTCCAGACCCATAACTATTCATGGGTTAGCACAATCTGGGGATGTTGTTGCCTTTAAA
AAGTTGCTAAATGACAACCCTTTTCTTCTTAATGAACGTAACCCTGTTATGGTGCAGACGCCTCTTCATGTTGCTACTGGTTACAACAAT
GTCGAAATACTCAAGTTTTTGCTCAGTTGGCCGGGCCCAGAGAAAGTGGAGCTGGAAGCCAAGAACATGTATGGAGAGACACCATTGCAC
ATGGCAGCCAAGAATGGTTGTAATGAAACAGCAAAGATGCTTCTTGCTCATGGTGCTCTTGTTGAAGCCAGAGCCAATAATGGGATGACT
CCGCTGCACCTTGCTGTTTGGCACTCATTACGAGCCGAAGACTATTCAACAGTAAAGACATTGTTGGAGTATAACGCAGATTGTAGTGCT
GAAGATGATGAGGGAAAGACTCCTATACATCATCTCTCTCAAGGCCCTGGAAATGAAAAGTTGCGTGAACTTCTCCACCAGTATCTTGAT
GAACXX\
Edits in Original Sequence 
AGTTTTTGTGTACCAAATGACTCACCTATGACTTGTTTGACAAAATTCCTCTGAGAGAAATTTTTTTTCTTGTGTTTACCCTTTTTCCCT
TCAATCTCTGTTCTGTTGTTGATACAGAGAGGGGAAACTAAGATAGGAAGAAGAA
(5')ATGCAGAGGACAAGGGATCAACGTTCAAGAT
CTTCCAGACCCATAACTATTCATGGGTTAGCACAATCTGGGGATGTTGTTGCCTTTAAAAAGTTGCTAAATGACAACCCTTTTCTTCTTA
ATGAACGTAACCCTGTTATGGTGCAGACGCCTCTTCATGTTGCTACTGGTTACAACAATGTCGAAATACTCAAGTTTTTGCTCAGTTGGC
CGGGCCCAGAGAAAGTGGAGCTGGAAGCCAAGAACATGTATGGAGAGACACCATTGCACATGGCAGCCAAGAATGGTTGTAATGAAACAG
CAAAGATGCTTCTTGCTCATGGTGCTCTTGTTGAAGCCAGAGCCAATAATGGGATGACTCCGCTGCACCTTGCTGTTTGGCACTCATTAC
GAGCCGAAGACTATTCAACAGTAAAGACATTGTTGGAGTATAACGCAGATTGTAGTGCTGAAGATGATGAGGGAAAGACTCCTATACATC
ATCTCTCTCAAGGCCCTGGAAATGAAAAGTTGCGTGAACTTCTCCACCAGTATCTTGATGAACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan