ESTScan Details for Unigene SGN-U221999

Score 
78
Direction 
Forward
Predicted Peptide Sequence 
TATPPSHLSATTLIVTTSQLYKLQPPPYSEWDWSSRIMFLTSHLFXKMNSRHLFGFSHLNLHKSKKXSEKLVRPAQWRLYVVLIVVVVLE
FSVVEGPIGDIAITYPXGVKLEKEDGGIPRVKQFV
Predicted Coding Sequence 
ACTGCCACACCTCCGTCGCACCTCTCCGCCACAACTCTCATCGTCACTACCTCACAACTCTATAAACTTCAGCCACCACCATATTCGGAA
TGGGATTGGAGTTCTAGGATAATGTTTTTGACTTCTCATCTATTTGAXAAAATGAACTCACGTCACCTCTTTGGATTTTCTCATCTGAAT
CTTCACAAATCTAAGAAGXACTCTGAGAAGCTTGTACGTCCTGCACAATGGCGTTTATATGTAGTTCTCATTGTTGTTGTCGTCTTAGAA
TTTTCTGTTGTTGAGGGACCTATAGGGGATATAGCCATAACTTATCCAXCAGGAGTAAAGCTTGAGAAGGAAGATGGTGGTATTCCAAGG
GTCAAACAATTTGTX\
Edits in Original Sequence 
(5')ACTGCCACACCTCaCGTCGCACCTCTCCGCCACAACTCTCATCGTCACTACCTCACAACTCTATAAACTTCAGCCACtCACCATAT
TCGGAATGGGATTGGAGTTCTAGGATAATGTTTTTGACTTCTCATCTATTTGAXAAAATGAACTCACGTCACCTCTTTGGATTTTCTCAT
CTGAATCTTCACAAATCTAAGAAGXACTCTGAGAAGCTTGTACGTCCTGCACAATGGCGTTTATATGTAGTTCTCATTGTTGTTGTCGTC
TTAGAATTTTCTGTTGTTGAGGGACCTATAGGGGATATAGCCATAACTTATCCAXCAGGAGTAAAGCTTGAGAAGGAAGATGGTGGTATT
CCAAGGGTCAAACAATTTGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan