ESTScan Details for Unigene SGN-U222023

Score 
1104
Direction 
Forward
Predicted Peptide Sequence 
TPLTLTGVCVPHLLXKEKGMALVSRIPSISSSSGATQLTKIKSFCVNPVCCINYASSSSSSPFTEKHSIERYQRDSWIYKNELEQQSSSC
PILPDPSYVRDYDIALQLPELKKMLQVLREKREGEGGCDRKGPGNVFLVGTGPGDPELLTVKALRVIQNADLLLYDRLVSNEVLDLVGPD
ARLLYVGKTAGYHSRTQEEIHELLLSFAEAGANVVRLKGGDPLVFGRGGEEMDFLQQKGIQVKVIPGITAASGISAELGIPLTHRGVTNS
VRFLTGHSRKGGTDPLFVAENAADPDSTLVAYXGLVNASFPGLEAHHHGLPTD
Predicted Coding Sequence 
XTTACACCTTTAACTCTCACTGGGGTGTGTGTCCCTCATCTTCTTGXAAAAGAAAAGGGTATGGCTCTTGTGAGTAGAATTCCTTCAATT
TCATCTTCTTCTGGAGCAACCCAATTGACAAAAATCAAATCTTTTTGTGTTAATCCTGTTTGCTGTATTAACTATGCATCATCATCTTCT
TCTTCCCCTTTTACTGAGAAGCATTCAATTGAGAGATACCAAAGGGATAGTTGGATATACAAGAATGAATTGGAGCAACAATCTAGTTCT
TGCCCAATTTTACCTGATCCTAGCTACGTGAGGGACTATGACATAGCTTTGCAGCTGCCTGAACTGAAGAAAATGCTTCAGGTTTTGAGG
GAGAAGAGAGAAGGGGAAGGAGGGTGTGATAGAAAAGGGCCTGGGAATGTGTTCTTGGTGGGTACTGGACCAGGTGATCCTGAGTTGTTG
ACTGTTAAGGCTTTGAGAGTTATTCAGAATGCTGATCTTTTGTTGTATGATAGATTGGTTTCTAATGAAGTCTTGGATTTGGTTGGTCCT
GATGCTAGGCTTCTCTATGTTGGTAAAACTGCTGGTTATCATAGCAGAACTCAGGAAGAAATTCATGAGTTGCTTCTGAGTTTTGCTGAA
GCTGGGGCCAATGTTGTGAGACTAAAAGGAGGTGACCCATTGGTATTTGGACGAGGAGGAGAAGAGATGGATTTTCTCCAACAAAAGGGA
ATTCAAGTTAAAGTTATTCCAGGTATTACTGCAGCATCTGGGATATCGGCGGAGTTGGGAATTCCATTAACCCATCGGGGTGTCACAAAT
AGTGTTAGATTTCTCACTGGTCACTCGAGAAAAGGAGGAACAGACCCACTTTTTGTTGCAGAGAATGCGGCTGACCCTGACTCTACATTA
GTTGCTTATXATGGGCTTGTCAACGCTTCCTTCCCTGGCCTCGAAGCTCATCATCATGGGTTGCCAACTGAT\
Edits in Original Sequence 
(5')XTTACACCTTTAACTCTCACTGGGGTGTGTGTCCCTCATCTTCTTGXAAAAGAAAAGGGTATGGCTCTTGTGAGTAGAATTCCTTC
AATTTCATCTTCTTCTGGAGCAACCCAATTGACAAAAATCAAATCTTTTTGTGTTAATCCTGTTTGCTGTATTAACTATGCATCATCATC
TTCTTCTTCCCCTTTTACTGAGAAGCATTCAATTGAGAGATACCAAAGGGATAGTTGGATATACAAGAATGAATTGGAGCAACAATCTAG
TTCTTGCCCAATTTTACCTGATCCTAGCTACGTGAGGGACTATGACATAGCTTTGCAGCTGCCTGAACTGAAGAAAATGCTTCAGGTTTT
GAGGGAGAAGAGAGAAGGGGAAGGAGGGTGTGATAGAAAAGGGCCTGGGAATGTGTTCTTGGTGGGTACTGGACCAGGTGATCCTGAGTT
GTTGACTGTTAAGGCTTTGAGAGTTATTCAGAATGCTGATCTTTTGTTGTATGATAGATTGGTTTCTAATGAAGTCTTGGATTTGGTTGG
TCCTGATGCTAGGCTTCTCTATGTTGGTAAAACTGCTGGTTATCATAGCAGAACTCAGGAAGAAATTCATGAGTTGCTTCTGAGTTTTGC
TGAAGCTGGGGCCAATGTTGTGAGACTAAAAGGAGGTGACCCATTGGTATTTGGACGAGGAGGAGAAGAGATGGATTTTCTCCAACAAAA
GGGAATTCAAGTTAAAGTTATTCCAGGTATTACTGCAGCATCTGGGATATCGGCGGAGTTGGGAATTCCATTAACCCATCGGGGTGTCAC
AAATAGTGTTAGATTTCTCACTGGTCACTCGAGAAAAGGAGGAACAGACCCACTTTTTGTTGCAGAGAATGCGGCTGACCCTGACTCTAC
ATTAGTTGCTTATXATGGGCTTGTCAACGCTTCCTTCCCTGGCCTCGAAGCTCATaCATCATGGGTTGCCAACTGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan