Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U222046

Score 
195
Direction 
Forward
Predicted Peptide Sequence 
PLTPNVHHHRNSAAASPHFLVPRMRHERLPPSPTPNNPRCPHCHSDFLEHMDSFTPTILPQFPNHPNPTSDIETPTTFTPSDDNFLLNSP
YLHRLIRHLTTTNDAPTPNLHNNSASRSAVAALELLQITSSMLENDPVILCAVCKDQFLLDMQVKMLPCKHMYHSDCILPWLEMNNSCPV
CRFQLPTEEDEVAVDXQDFVAAMRLEEFLGEQEDLFGFRAHLDVLPGGISLX
Predicted Coding Sequence 
CCACTTACACCAAATGTCCACCACCATCGCAACTCCGCCGCAGCGTCACCACACTTTTTGGTGCCACGAATGCGACATGAGCGTCTTCCT
CCTTCACCCACCCCGAATAATCCTCGCTGCCCTCACTGCCATTCCGATTTCCTCGAACATATGGACTCTTTTACCCCTACCATTCTTCCC
CAATTTCCGAATCACCCTAACCCTACCTCTGACATTGAAACCCCCACCACTTTTACTCCCTCTGACGACAACTTCCTCCTCAATAGTCCT
TATCTCCACCGTCTAATTCGCCATCTCACCACCACTAATGACGCTCCTACCCCCAATCTTCACAACAATTCCGCGTCCAGATCAGCTGTG
GCGGCACTTGAACTACTTCAAATTACCTCTTCCATGCTTGAGAATGATCCGGTTATTCTTTGTGCGGTCTGCAAAGACCAGTTTTTACTC
GACATGCAAGTTAAAATGTTGCCTTGCAAACACATGTATCATTCTGATTGTATTTTACCATGGTTAGAAATGAATAATTCATGTCCAGTT
TGTAGGTTCCAGTTACCTACGGAGGAAGACGAGGTTGCCGTAGACGXTCAGGATTTTGTTGCAGCAATGAGATTGGAAGAGTTTCTGGGT
GAGCAAGAAGATTTGTTTGGGTTTAGGGCACACTTAGACGTGTTGCCAGGAGGCATCAGCTTGAXX\
Edits in Original Sequence 
(5')CCACTTACACCAAATGTCCACCACCATCGCAACTCCGCCGCAGCGTCACCACACTTTTTGGTGCCACGAATGCGACATGAGCGTCT
TCCTCCTTCACCCAcCCCCGAATAATCCTCGCTGCCCTCACTGCCATTCCGATTTCCTCGAACATATGGACTCTTTTACCCCTACCATTC
TTCCCCAATTTCCGAATCACCCTAACCCTACCTCTGACATTGAAACCCCCACCACTTTTACTCCCTCTGACGACAACTTCCTCCTCAATA
GTCCTTATCTCCACCGTCTAATTCGCCATCTCACCACCACTAATGACGCTCCTACCCCCAATCTTCACAACAATTCCGCGTCCAGATCAG
CTGTGGCGGCACTTGAACTACTTCAAATTACCTCTTCCATGCTTGAGAATGATCCGGTTATTCTTTGTGCGGTCTGCAAAGACCAGTTTT
TACTCGACATGCAAGTTAAAATGTTGCCTTGCAAACACATGTATCATTCTGATTGTATTTTACCATGGTTAGAAATGAATAATTCATGTC
CAGTTTGTAGGTTCCAGTTACCTACGGAGGAAGACGAGGTTGCCGTAGACGXTCAGGATTTTGTTGCAGCAATGAGATTGGAAGAGTTTC
TGGGTGAGCAAGAAGATTTGTTTGGGTTTAGGcGCACACTTAGACGTGTTGCCAGGAGGCATCAGCTTGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan