ESTScan Details for Unigene SGN-U222081

Score 
258
Direction 
Forward
Predicted Peptide Sequence 
TSDVLLSLPIFPLAAFLVEKMAQKKYMTEHVVVTLHIIITTASILYPVLVILRCDSAFLSGVTLMMFACIVWMKLVSYAHTNYDMRQLAK
SVNEGENSEINYSYNVSFESLAYFMVAPTLCYQGWLARQLIKLVIFTGLMGFIIEQYINPIVRSSRHPFEGNLLYAIERVLKLSVPILYV
WLCMFYSLFHLWLNILAEVLRFGDREFYKDWWNAKTIDEYWRLWNMPVHKWMVRHIYFPCLRNGIPKGVAMVISFFISAVFHELCIAVPC
RLFKFWAFLGIMFQIPLVILTNFLQNKFKNSNVGNMTFWCFFCIVGQPMCVLLYYHDVMNRNGSSS
Predicted Coding Sequence 
XXCACTTCTGATGTGCTTCTTAGTCTTCCGATTTTCCCTCTTGCTGCTTTTCTTGTCGAGAAAATGGCACAGAAGAAGTATATGACTGAA
CATGTAGTTGTCACTCTTCACATAATTATAACGACAGCTTCCATTTTGTATCCAGTTCTGGTCATCCTCAGGTGTGATTCTGCTTTTCTA
TCGGGTGTCACACTGATGATGTTTGCTTGCATTGTGTGGATGAAACTAGTTTCTTATGCACATACAAATTATGATATGAGACAGCTTGCA
AAGTCTGTGAATGAGGGTGAGAATTCCGAAATCAACTACTCTTACAATGTTAGTTTCGAGAGTTTGGCTTACTTCATGGTTGCTCCAACT
TTATGCTATCAGGGTTGGCTGGCCCGCCAACTCATCAAGCTGGTAATTTTTACAGGATTAATGGGATTTATCATTGAGCAGTATATTAAC
CCGATTGTGCGAAGCTCACGACATCCATTTGAAGGAAACCTTTTATACGCCATCGAGAGGGTATTGAAGCTTTCAGTTCCAATTTTATAT
GTCTGGCTCTGCATGTTCTACAGCCTCTTTCATCTTTGGTTAAATATACTTGCGGAAGTTCTGCGATTTGGGGATCGTGAGTTCTATAAA
GATTGGTGGAACGCAAAAACAATTGATGAGTATTGGAGACTTTGGAATATGCCTGTACATAAGTGGATGGTTCGTCACATCTATTTCCCA
TGCTTAAGAAATGGCATACCTAAGGGAGTTGCAATGGTGATCTCTTTCTTTATATCTGCTGTTTTCCATGAGCTGTGTATTGCTGTTCCT
TGTCGGCTATTCAAGTTTTGGGCATTCCTTGGAATCATGTTTCAGATTCCCTTGGTCATACTAACGAACTTCCTGCAAAACAAGTTCAAA
AACTCGAATGTGGGCAACATGACATTCTGGTGCTTTTTCTGCATTGTTGGTCAACCAATGTGTGTGCTTCTGTATTACCATGATGTGATG
AATAGAAATGGTAGCTCAAGTTAA\
Edits in Original Sequence 
(5')XXCACTTCTGATGTGCTgTCTTAGTCTTCCGATTTTCCCTCTTGCTGCTTTTCTTGTCGAGAAAATGGCACAGAAGAAGTATATGA
CTGAACATGTAGTTGTCACTCTTCACATAATTATAACGACAGCTTCCATTTTGTATCCAGTTCTGGTCATCCTCAGGTGTGATTCTGCTT
TTCTATCGGGTGTCACACTGATGATGTTTGCTTGCATTGTGTGGATGAAACTAGTTTCTTATGCACATACAAATTATGATATGAGACAGC
TTGCAAAGTCTGTGAATGAGGGTGAGAATTCCGAAATCAACTACTCTTACAATGTTAGTTTCGAGAGTTTGGCTTACTTCATGGTTGCTC
CAACTTTATGCTATCAGGGTTGGCTGGCCCGCCAACTCATCAAGCTGGTAATTTTTACAGGATTAATGGGATTTATCATTGAGCAGTATA
TTAACCCGATTGTGCGAAGCTCACGACATCCATTTGAAGGAAACCTTTTATACGCCATCGAGAGGGTATTGAAGCTTTCAGTTCCAATTT
TATATGTCTGGCTCTGCATGTTCTACAGCCTCTTTCATCTTTGGTTAAATATACTTGCGGAAGTTCTGCGATTTGGGGATCGTGAGTTCT
ATAAAGATTGGTGGAACGCAAAAACAATTGATGAGTATTGGAGACTTTGGAATATGCCTGTACATAAGTGGATGGTTCGTCACATCTATT
TCCCATGCTTAAGAAATGGCATACCTAAGGGAGTTGCAATGGTGATCTCTTTCTTTATATCTGCTGTTTTCCATGAGCTGTGTATTGCTG
TTCCTTGTCGGCTATTCAAGTTTTGGGCATTCCTTGGAATCATGTTTCAGATTCCCTTGGTCATACTAACGAACTTCCTGCAAAACAAGT
TCAAAAACTCGAATGTGGGCAACATGACATTCTGGTGCTTTTTCTGCATTGTTGGTCAACCAATGTGTGTGCTTCTGTATTACCATGATG
TGATGAATAGAAATGGTAGCTCAAGTTAA\(3')AGCTTCATCGTCGATCATTTTGTTGGACCGCGACTCACTAGTGAGTATCGCAGTTT
TGAACTATCTGATGCTTTACTTATATGCTTGAAATGGAGAAAATTCTTTTCTAAAATTTGACACCAAGGAGAGTGAACAGAATTGTTGCT
TTGTATTATATCTTTCTTTTGATATTTAAGAAATGTATATCGATTTTTGTTGAGGTAAAATGTCATAAGCTCAAATTAGTGATAGTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan