ESTScan Details for Unigene SGN-U222085

Score 
140
Direction 
Reverse
Predicted Peptide Sequence 
MTNTQQKFQFQITQKKIPSASSSIXSHQCLLRPSEYCESGTTSDNGVDIGVGNGEFRQTGHEAFNFSHHLRTSHENNAYTQVTSVTSPLP
CNRTNKSHTRRRFCFRFRFPNFRFCLSKLIWVRVDYCLIEARESVRDETSSFSSSSATKITLGXVNSGVRVSRLGLGLTAAIGSGAAAXG
XDERMRVDRRKRKARAIAIAVAEAYFVEALDELLVVVRGGGGTAVAAEGMVDIGRILREAPLD
Predicted Coding Sequence 
ATGACTAATACTCAACAGAAATTCCAATTTCAAATTACACAAAAGAAAATTCCAAGCGCTTCCTCATCTATTNTCAGTCATCAATGTCTT
CTCCGACCATCGGAATATTGTGAAAGTGGGACCACCTCCGACAACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGA
CATGAAGCATTCAATTTCAGCCACCATCTACGCACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCT
TGTAATCGCACAAACAAATCGCACACACGACGTCGTTTCTGCTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATT
TGGGTAAGAGTTGATTACTGCTTGATTGAGGCCCGCGAAAGTGTTCGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATT
ACACTCGGAXATGTAAATTCCGGTGTTCGGGTTTCGAGACTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGT
AAXGATGAAAGGATGAGAGTTGATAGGAGGAAGAGGAAGGCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTC
GATGAGCTATTGGTGGTGGTTAGAGGTGGTGGTGGXACCGCCGTGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCT
CCATTAGATTAA\
Edits in Original Sequence 
AAGATAAAATAAAATATTATTAGATCTAGAAATATATTCTTTCTTTGAAATCTAAAATCAGAGA(5')ATGACTAATACTCAACAGAAAT
TCCAATTTCAAATTACACAAAAGAAAATTCCAAGCGCTTCCTCATCTATTNTCAGTCATCAATGTCTTCTCCGACCATCGGAATATTGTG
AAAGTGGGACCACCTCCGACAACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGACATGAAGCATTCAATTTCAGCC
ACgCATCTACGCACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCTTGTAATCGCACAAACAAATCG
CACACACGACGTCGTTTCTGCTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATTTaGGGTAAGAGTTGATTACTG
CTTGATTGAGGCCCGCGAAAGTGTTCtGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATTACACTCGGAXATGTAAATT
CCGGTGTTCGGGTTTCGAGACTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGTAAXGATGAAAGGATGAGAG
TTGATAGGAGGAAGAGGAAGGCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTCGATGAGCgTATTGGTGGTG
GTTAGAGGTGGTGGTGGXACCGCCGTaGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCTCCATTAGATTAA\(3')
AGGGAAAAAATATGGTTTAGATAGGTGGGTGGGTGCATGGGTGGGTGGTATAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan