ESTScan Details for Unigene SGN-U222158

Score 
551
Direction 
Forward
Predicted Peptide Sequence 
MFKKFSTEEVSGQNQVKASVQRRIRQSIAEEYPLLEPVLEDLLPKKSPLIVAKCQNHLNLVVVNNVPLFFNIRDGPYMPTLRLLHQYPNI
MKKLQVDRGAIKFVLSGANIMCPGLTSPGGALDVEVGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKMERL
D
Predicted Coding Sequence 
ATGTTCAAGAAGTTTTCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAAGCATTGCAGAA
GAGTACCCACTACTAGAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATCATCTGAATTTA
GTTGTGGTAAACAATGTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAATATCCAAATATA
ATGAAAAAACTACAAGTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTTCTCCTGGGGGT
GCTTTGGATGTTGAAGTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCTTTACAAAGATG
TCGGCAAAGGATATAAAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGATGGAGCGTCTG
GATTGA\
Edits in Original Sequence 
CTGTCAATAAAATGGAGAACTCAATTGCCAAATTTGGTAATTCATCGCTTAAACCCTAACCCCCCCTCTCTCTCTCGCTCATCGTCAGCC
CGTGAAA
(5')ATGTTCAAGAAGTTTTCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAA
GCATTGCAGAAGAGTACCCACTACTAGAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATC
ATCTGAATTTAGTTGTGGTAAACAATGTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAAT
ATCCAAATATAATGAAAAAACTACAAGTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTT
CTCCTGGGGGTGCTTTGGATGTTGAAGTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCT
TTACAAAGATGTCGGCAAAGGATATAAAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGA
TGGAGCGTCTGGATTGA\(3')GCTTTAAATGGTATCTTTACTAGATGGACAATGTTTACCTGCTGCAAATAGCAAAGACTTGCTCATTT
TTATGCAGCTGTTATTTCGTTTCTCCAGATGTTAATGAGCAAGCTGAACCAAAGTTTCTTAATTTAATGAAGGGGAGCCAAGTTTTAGGG
GATTTATACAATTTATGATTATTGTTTTGGAACTACAAATTTTCTTAATCCGCTCGATCAAAGGAACATGAGTGGTGTTTGTGTCTGAAT
CTTAACTTTGGACAATCAAGATAATCAAAAGTTAAATATACAAAAAAAGGCCAATGAAATTTACAAAAAAAAAAAAAAAAAAAAAAAAAA
AAACTCGAACTAGTTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan