ESTScan Details for Unigene SGN-U222513

Score 
1252
Direction 
Forward
Predicted Peptide Sequence 
MTTIPVIDFSKLYGEERAQTLAQISKGCEEWGFFQLVNHGIPVELLERVKKVGEECFKLEREEVFNKSRVVNLLNEFVESNKNGKVENVD
WEDVFLLTDDNCNQWPSKTPQFKETMKEYRSEVKKLAERVMEVMDENLGLSKGYIKKAFNNNNNNDAFFGTKVSHYPPCPHPEKVNGLRA
HTDAGGVILLFQDDQVDGLQILKNGQWIDVPPIPNAIVINTGDQIEVLSNGKYKSVWHRVLSKPDGNRRSIASFYNPSLKATISPAPELL
ILEEKKVDQLIATYPTFVFGNYMNVYNEQKFLPKEPRFQAVAAI
Predicted Coding Sequence 
ATGACTACTATTCCGGTTATTGATTTTTCAAAACTTTATGGAGAGGAAAGAGCCCAAACTTTGGCTCAAATTTCCAAAGGTTGTGAAGAA
TGGGGATTCTTTCAGTTGGTGAATCATGGGATACCAGTGGAGTTATTAGAAAGGGTGAAGAAAGTTGGTGAAGAATGCTTTAAGTTGGAA
AGAGAAGAAGTGTTCAACAAGTCAAGAGTAGTGAATTTGCTTAATGAATTTGTGGAAAGCAATAAAAATGGCAAAGTTGAAAATGTGGAT
TGGGAAGATGTATTCCTTCTAACTGATGATAATTGTAATCAATGGCCCTCCAAAACTCCTCAATTCAAGGAAACAATGAAAGAGTATAGA
TCAGAGGTGAAAAAGCTAGCAGAAAGAGTGATGGAAGTAATGGATGAAAATTTAGGTTTATCAAAAGGTTACATCAAGAAAGCCTTCAAT
AACAACAATAATAATGATGCATTTTTTGGTACAAAAGTGAGTCATTACCCACCATGTCCACATCCAGAAAAGGTGAATGGTCTAAGAGCT
CACACTGATGCTGGTGGTGTCATTTTGCTCTTTCAAGATGATCAAGTTGATGGTCTTCAAATCCTCAAAAATGGACAATGGATCGATGTA
CCTCCTATCCCTAACGCCATCGTGATCAACACAGGTGATCAAATCGAAGTGCTTAGCAATGGGAAATACAAGAGCGTTTGGCACCGTGTC
TTGTCAAAACCAGATGGTAATAGGAGATCAATTGCTTCATTCTATAATCCTTCATTGAAAGCCACCATTTCTCCAGCACCAGAGCTGCTA
ATTTTGGAAGAAAAAAAAGTGGATCAATTAATTGCTACTTATCCAACTTTTGTGTTTGGGAATTACATGAATGTTTATAATGAGCAAAAG
TTCCTTCCTAAAGAACCAAGGTTCCAAGCTGTGGCTGCAATCTAG\
Edits in Original Sequence 
ATTGCTGTTATTTCACTATATATTCTCTAATTAATCTCTTTTTTTTTGTTTAATTTTTTGCTTAACA(5')ATGACTACTATTCCGGTTA
TTGATTTTTCAAAACTTTATGGAGAGGAAAGAGCCCAAACTTTGGCTCAAATTTCCAAAGGTTGTGAAGAATGGGGATTCTTTCAGTTGG
TGAATCATGGGATACCAGTGGAGTTATTAGAAAGGGTGAAGAAAGTTGGTGAAGAATGCTTTAAGTTGGAAAGAGAAGAAGTGTTCAACA
AGTCAAGAGTAGTGAATTTGCTTAATGAATTTGTGGAAAGCAATAAAAATGGCAAAGTTGAAAATGTGGATTGGGAAGATGTATTCCTTC
TAACTGATGATAATTGTAATCAATGGCCCTCCAAAACTCCTCAATTCAAGGAAACAATGAAAGAGTATAGATCAGAGGTGAAAAAGCTAG
CAGAAAGAGTGATGGAAGTAATGGATGAAAATTTAGGTTTATCAAAAGGTTACATCAAGAAAGCCTTCAATAACAACAATAATAATGATG
CATTTTTTGGTACAAAAGTGAGTCATTACCCACCATGTCCACATCCAGAAAAGGTGAATGGTCTAAGAGCTCACACTGATGCTGGTGGTG
TCATTTTGCTCTTTCAAGATGATCAAGTTGATGGTCTTCAAATCCTCAAAAATGGACAATGGATCGATGTACCTCCTATCCCTAACGCCA
TCGTGATCAACACAGGTGATCAAATCGAAGTGCTTAGCAATGGGAAATACAAGAGCGTTTGGCACCGTGTCTTGTCAAAACCAGATGGTA
ATAGGAGATCAATTGCTTCATTCTATAATCCTTCATTGAAAGCCACCATTTCTCCAGCACCAGAGCTGCTAATTTTGGAAGAAAAAAAAG
TGGATCAATTAATTGCTACTTATCCAACTTTTGTGTTTGGGAATTACATGAATGTTTATAATGAGCAAAAGTTCCTTCCTAAAGAACCAA
GGTTCCAAGCTGTGGCTGCAATCTAG\(3')ACTAGTTTTTTTTAAATATGATTATGCATGCCTACCAACTTCTTTTCATTCAGTTTTTA
GATTAAATAAAGGTCGTATGTATAATTAGTTTTTGTATCTCCTCTTCATTTTAAAATAAATCTGTCCATTCTTGTCTTTGTAAAAAAAAA
AAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan