Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U222671

Score 
192
Direction 
Forward
Predicted Peptide Sequence 
ERIGKAKQEFQAIIRDPFMLNAVILVFANKQDMKGAMTPMEVCEGLGLYDLKNRKWHIQGACALKGDGLYEGLDWLSSTLKDLKAAGYSS
VGTSALLIDQAYKNLFRGTKLITLPSVN
Predicted Coding Sequence 
GAGAGAATCGGAAAGGCAAAGCAAGAGTTTCAGGCAATCATTAGAGATCCATTTATGCTTAATGCTGTTATCTTGGTTTTCGCTAACAAG
CAGGACATGAAAGGAGCAATGACTCCAATGGAAGTGTGTGAAGGCCTCGGTCTTTATGATCTTAAAAACCGGAAATGGCATATACAAGGT
GCATGTGCTCTTAAAGGGGATGGTCTATATGAGGGACTAGACTGGTTATCAAGCACTTTGAAAGATCTCAAGGCCGCTGGGTACTCTTCA
GTGGGGACTTCTGCXCTTCTGATTGATCAGGCTTACAAGAACCTATTTCGAGGGACAAAGCTGATTACCCTGCCGTCTGTAAATTAA\
Edits in Original Sequence 
(5')GAGAGAATCGGAAAGGCAAAGCAAGAGTTTCAGGCAATCATTAGAGATCCATTTATGCTTAATGCTGTTATCTTGGTTTTCGCTAA
CAAGCAGGACATGAAAGGAGCAATGACTCCAATGGAAGTGTGTGAAGGCCTCGGTCTTTATGATCTTAAAAACCGGAAATGGCATATACA
AGGTGCATGTGCTCTTAAAGGGGATGGTCTATATGAGGGACTAGACTGGTTATCAAGCACTTTGAAAGATCTCAAGGCCGCTGGGTACTC
TTCAGTGGGGACTTCTGCXCTTCTGATTGATCAGGCTTACtAAGAACCTATTTCGAGGGACAAAGCTGATTACCCTGCCGTCTGTAAATT
AA\(3')AACGCCTGAACTCACATTGAACATTGTTACTTGTTCTTTCGGGTCTGTGCTTTTAAATAGTGGAATCCTGATCTAGGGTGAAG
CTTGACTTTTGATTCTGCTGTATCCTGAAAATGTGGGCCTTGCAATTGGTCTTCCGCGTATACAAGAATTGTGTATGTTGATACCTACTG
TAGTATTTTAAGTATGTATAACTTCCACATGAAATAGGTGATCATTGATCTCCCTAACAAGCATGCCAAATCGATCCCCTTAAAAAAAAA
AAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan