ESTScan Details for Unigene SGN-U222806

Score 
431
Direction 
Forward
Predicted Peptide Sequence 
DNTLIASHFKKWNTAPSSIFARWFHCKKNIIHCPTSRLNSPYPLTLHLMLADRNSQALAVNQIVFILVWQHLEFDFYRYSSGYXFGSSRI
GDTIIAQSRILMFWYYTTYLLLEKNKPKYQRLEPPLRLKDIEEEPEEEAKLQPVKDDDLPEPTQQVESPPSDEGKPDEQQESSPADPLDL
FTLDXLVNCLGKMDDVDNEDMDFFIDLSPTGAYQKEMLXAVKGAXFYVSY
Predicted Coding Sequence 
GACAACACTCTAATAGCTTCACATTTCAAAAAGTGGAATACTGCTCCCTCTTCGATCTTCGCGAGGTGGTTCCATTGCAAGAAAAATATT
ATTCACTGTCCAACTTCAAGATTAAATTCACCATATCCTCTCACACTTCATCTTATGCTTGCTGATCGAAATTCCCAAGCATTGGCAGTG
AATCAAATTGTTTTCATCCTTGTGTGGCAACATCTTGAATTTGACTTCTACAGGTACTCGAGCGGCTATXCATTTGGAAGCAGCCGAATA
GGTGATACCATTATTGCTCAAAGTAGAATACTCATGTTTTGGTATTACACAACTTACCTTCTCCTGGAGAAAAATAAGCCCAAGTATCAA
CGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAGGATGATGATTTGCCT
GAACCAACTCAACAAGTTGAATCTCCTCCCTCAGATGAAGGTAAACCCGACGAGCAGCAGGAATCTTCTCCTGCTGATCCACTTGATCTG
TTTACCCTTGACGXGCTTGTAAATTGCTTGGGAAAAATGGATGATGTTGATAACGAAGATATGGACTTTTTTATTGATTTATCTCCTACA
GGTGCTTATCAAAAGGAGATGCTTGXTGCAGTAAAAGGAGCTCNTTTCTATGTGAGCTATTGA\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTAAACCAAGGTGATAATAAACATAGATAACTGGCAACCTGNGAGAGTTGTAGTTAATACATACCTAAAATCTATA
GTA
(5')GACAACACTCTAATAGCTTCACATTTCAAAAAGTGGAATACTGCTCCCTCTTCGATCTTCGCGAGGTGGTTCCATTGCAAGAA
AAATATTATTCACTGTCCgAACTTCAAGATTAAATTCACCATATCCTCTCACACTTCATCTTATGCTTGCTGATCGAAATTCCCAAGCAT
TGGCAGTGAATCAAATTGTTTTCATCCTTGTGTGGCAACATCTTGAATTTGACTTCTACAGGTACTCGAGCGGCTATXCATTTGGAAGCA
GCCGAATAGGTGATACCATTATTGCTCAAAGTAGAATACTCATGTTTTGGTATTACACAACTTACCTTCTCCTGGAGAAAAATAAGCCCA
AGTATCAACGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAGGATGATG
ATTTGCCTGAACCAACTCAACAAGTTGAATCTCCTCCCTCAGATGAAGGTAAACCCGACGAGCAGCAGGAATCTTCTCCTGCTGATCCAC
TTGATCTGTTTACCCTTGACGXGCTTGTAAATTGCTTGGGAAAAATGGATGATGTTGATAACGAAGATATGcGACTTTTTTATTGATTTA
TCTCCTACAGGTGCTTATCAAAAGGAGATGCTTGXTGCAGTAAAAGGAGCTCNTTTCTATGTGAGCTATTGA\(3')GCTAATTCTACTA
ATATGCAGTAAATTCCTCCCCTTCCTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan