ESTScan Details for Unigene SGN-U222807

Score 
689
Direction 
Forward
Predicted Peptide Sequence 
IASALIFGSVSGGWADHKRQYKTGWDXLQVAAINTAMAALTKTVGVFPKERAIVDRERAKGSYALGPYLLSKLIAEIPVGAAFPLLFGGI
LYPMARLHPTISRFGKFCAIVTVESFAASAMGLTVGAMVPTTEAALALGPSLMTVFIVFGGYYVNSDNTPIIFQWIPRVSLIRWAFQGLS
INEFSGLQFEHQKTSDIQSGEQVLERLSFGSSRIGDTIIAQSRILMFWYYTTYLLLEKNKPKYQRLEPPLRLKDIEEEPEEEAKLQPVKD
DDLPEPTQQVESP
Predicted Coding Sequence 
XXAATTGCTTCAGCTTTGATATTTGGTTCTGTTTCTGGAGGATGGGCAGATCACAAACGTCAATACAAGACAGGATGGGATXTACTTCAG
GTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAAACAGTTGGTGTCTTTCCCAAGGAACGAGCAATTGTTGATAGAGAGCGTGCA
AAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAGTTGATTGCTGAGATTCCTGTTGGGGCAGCATTTCCTCTACTCTTTGGTGGC
ATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCTAGATTTGGGAAGTTCTGCGCAATCGTGACGGTGGAGTCTTTTGCTGCATCT
GCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACTGAAGCTGCATTAGCGTTAGGCCCCTCTCTTATGACAGTTTTTATTGTCTTT
GGAGGGTACTATGTCAATTCAGACAACACACCAATTATTTTTCAGTGGATTCCTCGAGTTTCTTTAATAAGATGGGCGTTTCAGGGGCTT
AGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAAAAGACATCTGACATACAGTCTGGTGAACAGGTACTCGAGCGGCTATCATTT
GGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGTAGAATACTCATGTTTTGGTATTACACAACTTACCTTCTCCTGGAGAAAAAT
AAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAG
GATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCTCCX\
Edits in Original Sequence 
(5')XXAATTGCTTCAGCTTTGATATTTGGTTCTGTaTTCTGGAGGATGGGCAGATCACAAACGTCAATACAAGACAGGATGGGATXTAC
TTCAGGTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAAACAGTTGGTGTCTTTCCCAAGGAACGAGCAATTGTTGATAGAGAGC
GTGCAAAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAGTTGATTGCTGAGATTCCTGTTGGGGCAGCATTTCCTCTACTCTTTG
GTGGCATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCTAGATTTGGGAAGTTCTGCGCAATCGTGACGGTGGAGTCTTTTGCTG
CATCTGCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACTGAAGCTGCATTAGCGTTAGGCCCCTCTCTTATGACAGTTTTTATTG
TCTTTGGAGGGTACTATGTCAATTCAGACAACACACCAATTATTTTTCAGTGGATTCCTCGAGTTTCTTTAATAAGATGGGCGTTTCAGG
GGCTTAGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAAAAGACATCTGACATACAGTCTGGTGAACAGGTACTCGAGCGGCTAT
CATTTGGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGTAGAATACTCATGTTTTGGTATTACACAACTTACCTTCTCCTGGAGA
AAAATAAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCG
TAAAGGATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCTCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan