ESTScan Details for Unigene SGN-U222957

Score 
671
Direction 
Forward
Predicted Peptide Sequence 
IRFIYCINPFLQLPDLLLLHTSEAEEVMKIQCNVCEVAEANVLCCADEAALCWSCDEKVHAANKLASKHQRVPLSGSSSSMPMCDICQET
VGYFFCLEDRALLCRKCDIAIHTANPHVAAHQRFLLTGVKVGLEPVDPGGISSSGTSQSIQKVSEPESAPLSKRNASVSLDAQFNKVLPT
QVSGIEDFAPTKSPFAGGSAAGSMPQWQFDEFIGLSDFNQNYGYMDDGSSKADNGKLGGESX
Predicted Coding Sequence 
XTTATTCGTTTCATTTACTGCATAAACCCATTTTTGCAACTTCCAGATCTTTTGCTTCTTCATACGTCGGAGGCTGAAGAAGTGATGAAG
ATTCAGTGTAATGTTTGTGAGGTTGCGGAGGCGAACGTGTTGTGCTGCGCCGATGAGGCGGCGTTGTGTTGGTCGTGTGATGAGAAGGTT
CATGCTGCTAATAAGCTTGCTAGTAAACATCAGAGAGTTCCTTTATCTGGTTCTTCTTCATCTATGCCTATGTGTGATATCTGCCAGGAA
ACAGTTGGCTACTTCTTTTGTCTTGAGGATCGGGCATTACTTTGCCGAAAATGTGATATTGCTATTCACACAGCTAATCCTCATGTTGCT
GCTCACCAAAGATTTTTGCTGACTGGAGTGAAAGTAGGACTTGAACCTGTTGATCCTGGTGGTATTTCATCCTCAGGGACATCACAGTCC
ATTCAGAAGGTTTCTGAGCCAGAGTCTGCTCCACTTTCAAAACGGAATGCCTCAGTATCATTGGATGCTCAATTTAACAAAGTGTTACCT
ACCCAGGTCAGTGGCATTGAGGATTTTGCTCCTACTAAGTCTCCGTTTGCTGGAGGTTCTGCAGCTGGAAGTATGCCACAATGGCAGTTC
GATGAATTTATTGGTCTGAGTGATTTCAATCAAAATTATGGATACATGGATGATGGATCATCTAAGGCGGATAATGGCAAACTTGGTGGA
GAGTCGGXX\
Edits in Original Sequence 
(5')XTTATTCGTTTCATTTACTGCATAAACCCATTTTTGCAACTTCCAGATCTTTTGCTTCTTCATACGTCGGAGtGCTGAAGAAGTGA
TGAAGATTCAGTGTAATGTTTGTGAGGTTGCGGAGGCGAACGTGTTGTGCTGCGCCGATGAGGCGGCGTTGTGTTGGTCGTGTGATGAGA
AGGTTCATGCTGCTAATAAGCTTGCTAGTAAACATCAGAGAGTTCCTTTATCTGGTTCTTCTTCATCTATGCCTATGTGTGATATCTGCC
AGGAAACAGTTGGCTACTTCTTTTGTCTTGAGGATCGGGCATTACTTTGCCGAAAATGTGATATTGCTATTCACACAGCTAATCCTCATG
TTGCTGCTCACCAAAGATTTTTGCTGACTGGAGTGAAAGTAGGACTTGAACCTGTTGATCCTGGTGGTATTTCATCCTCAGGGACATCAC
AGTCCATTCAGAAGGTTTCTGAGCCAGAGTCTGCTCCACTTTCAAAACGGAATGCCTCAGTATCATTGGATGCTCAATTTAACAAAGTGT
TACCTACCCAGGTCAGTGGCATTGAGGATTTTGCTCCTACTAAGTCTCCGTTTGCTGGAGGTTCTGCAGCTGGAAGTATGCCACAATGGC
AGTTCGATGAATTTATTGGTCTGAGTGATTTCAATCAAAATTATGGATACATGGATGATGGATCATCTAAGGCGGATAATGGCAAACTTG
GTGGAGAGTCGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan