ESTScan Details for Unigene SGN-U223039

Score 
410
Direction 
Forward
Predicted Peptide Sequence 
NGKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELTPNVDLEAIANMTEGYSGSD
LKNLCVTAAHCPIREILEKEKKEKALAVSDSRPVPALHSSVDVRPLNKDDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKKSL
SYFM
Predicted Coding Sequence 
AATGGGAAAATGAAGAATGAATTCATGGTGAATTGGGATGGCTTGCGTACAAAGGACAAGGAGCGAGTTCTTGTACTTGCTGCAACTAAT
AGACCATTCGACCTTGATGAAGCAGTTATTAGGAGACTTCCACGGAGGTTGATGGTAAACTTGCCAGATGCTCCGAACAGGGAGAAAATT
TTGAGAGTGATATTGGCCAAGGAAGAGTTAACGCCAAATGTTGATCTGGAAGCTATAGCAAATATGACTGAAGGGTATTCCGGAAGTGAT
TTAAAGAATTTATGTGTCACAGCTGCTCATTGCCCAATTAGAGAAATATTGGAGAAAGAGAAAAAGGAAAAAGCATTGGCAGTTTCAGAT
AGCAGGCCAGTCCCTGCATTGCATAGTAGTGTGGACGTTCGCCCCCTTAACAAGGATGATTTTAAATATGCACATGAACAGGTATGTGCT
AGTGTATCTTCAGAATCGGCAAACATGAATGAGTTACTCCAGTGGAATGAATTGTATGGAGAAGGTGGATCAAGGAAGAAGAAATCTCTC
AGTTACTTCATGTAG\
Edits in Original Sequence 
(5')AATGcGGAAAATGAAGAATGAATTCATGGTGAATTGGGATGGCTTGCGTACAAAGGACAAGGAGCGAGTTCTTGTACTTGCTGCAA
CTAATAGACCATTCGACCTTGATGAAGCAGTTATTAGGAGACTTCCACGGAGGTTGATGGTAAACTTGCCAGATGCTCCGAACAGGGAGA
AAATTTTGAGAGTGATATTGGCCAAGGAAGAGTTAACGCCAAATGTTGATCTGGAAGCTATAGCAAATATGACTGAAGGGTATTCCGGAA
GTGATTTAAAGAATTTATGTGTCACAGCTGCTCATTGCCCAATTAGAGAAATATTGGAGAAAGAGAAAAAGGAAAAAGCATTGGCAGTTT
CAGATAGCAGGCCAGTCCCTGCATTGCATAGTAGTGTGGACGTTCGCCCCCTTAACAAGGATGATTTTAAATATGCACATGAACAGGTAT
GTGCTAGTGTATCTTCAGAATCGGCAAACATGAATGAGTTACTCCAGTGGAATGAATTGTATGGAGAAGGTGGATCAAGGAAGAAGAAAT
CTCTCAGTTACTTCATGTAG\(3')AGACATGTGAAGTGTATAGTGTTGCTTTATTTATTTACCCAAGTTGGTAGGGACGGGTCCTGCAT
GCATGGAAATCCATTTCAGGTTCCCTGGAGTCCAAACCCCCAACCGCGGAAAACTGTGTATCATAGTTAGTTAATAGTTATGAAATATCT
ATCTATCCGAAGCTTGTCTTCCAATTTTCACCTTATTGGATCTCCTCTGTATATACAATTTGATTTATTTAATAAATAAACATCCCCATG
CTCTTTTTTGTTTTCCATTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan