ESTScan Details for Unigene SGN-U223105

Score 
440
Direction 
Forward
Predicted Peptide Sequence 
KASGAASQFLDTLRSQLPKMAEFANSKNYGVPIYGAGWVPPSALRSAVEPSVDDEKDDGDKSSSSAPGNYVVLAGGGGEGNSGIRNALIV
AQFDFDSNVLSDEPVARLGTGGDLPYRMAVHPGGEGLIAHCQKAADGLTGIFRXDENRSLGLRSSEKVLEPLEDVGQQLALTFNDEGSLL
AVGGEVDXLSLKLFQVEMKVWLLLAIEGKMLNVKALLFCSLYMKYLRRPVSVSSX
Predicted Coding Sequence 
AAAGCCTCTGGTGCXGCATCTCAATTTCTCGATACGCTGAGATCACAGTTACCGAAGATGGCTGAATTTGCCAATTCCAAAAACTACGGA
GTCCCAATTTACGGTGCCGGTTGGGTTCCACCGAGCGCTCTCAGATCTGCCGTTGAACCGTCGGTCGATGATGAAAAGGACGACGGAGAC
AAATCATCGTCATCGGCACCGGGAAACTATGTTGTTCTTGCCGGAGGTGGTGGGGAAGGGAATAGCGGTATTCGTAATGCTCTCATTGTT
GCTCAATTCGATTTTGATTCTAATGTGCTCTCTGATGAACCCGTGGCTAGGTTAGGAACTGGCGGTGATCTGCCTTATAGGATGGCAGTA
CATCCAGGTGGAGAAGGTCTTATTGCTCATTGCCAAAAAGCTGCAGATGGTTTGACTGGGATTTTCAGAXCAGATGAAAATCGTTCATTG
GGTCTGCGATCATCTGAGAAAGTACTTGAGCCATTGGAAGATGTTGGACAACAACTAGCACTAACTTTTAACGATGAAGGTTCTTTACTT
GCTGTCGGTGGTGAGGTAGATXATCTTTCCCTTAAACTATTTCAGGTTGAAATGAAAGTATGGTTGTTGCTTGCCATTGAAGGAAAAATG
CTCAATGTGAAGGCACTACTGTTTTGTTCATTGTATATGAAATATTTACGTAGACCAGTTTCTGTAAGCTCTGXX\
Edits in Original Sequence 
(5')AAAGCCTCTGGTGCXGCATCTCAATTTCTCGATACGCTGAGATCACAGTTACCGAAGATGGCTGAATTTGCCAATTCCAAAAACTA
CGGAGTCCCAATTTACGGTGCCGGTTGGGTTCCACCGAGCGCTCTCAGATCTGCCGTTGAACCGTCGGTCGATGATGAAAAGGACGACGG
AGACAAATCATCGTCATCGGCACCGGGAAACTATGTTGTTCTTGCCGGAGGTGGTGGGGAAGGGAATAGCGGTATTCGTAATGCTCTCAT
TGTTGCTCAATTCGATTTTGATTCTAATGTGCTCTCTGATGAACCCGTGGCTAGGTTAGGAACTGGCGGTGATCTGCCTTATAGGATGGC
AGTACATCCAGGTGGAGAAGGTCTTATaTGCTCATTGCCAAAAAGCTGCAGATGGTTTGACTGGGATTTTCAGAXCAGATGAAAATCGTT
CATTGGGTCTGCGATCATCTGAGAAAGTACTTGAGCCATTGGAAGATGTTGGACAACAACTAGCACTAACTTTTAACGATGAAGGTTCTT
TACTTGCTGTCGGTGGTGAGGTAGATXATCTTTCCCTTAAACTATTTCAGGTTGAAATGAAAGTATGGTTGTTGCTTGCCATTGAAGGAA
AAATGCTCAATGTGAAGGCACTACTGTTTTGTTCATTGTATATGAAATATTTACGTAGACCAGTTTCTGTAAGCTCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan