ESTScan Details for Unigene SGN-U223193

Score 
1065
Direction 
Forward
Predicted Peptide Sequence 
GHGWLRPAIGVVELSQSIVQAVPLSARKAAGGSSEGYAPFLQLPHFSEAVVKKIARKKVRTFQDFRDMTPDERADLLTQVAGFSNGESHD
VEMVLEMMPSVTIDITCETEGEEGIQEGDIVTMHAWVTLNRGSGLIRALPHCPYFPFDKEENFWLMLADSFSNDVWLSQKVSFMDEATSI
IAVSKTIQESKEGSGASAREINVAVKEAIEKVKNGSRLVMGKFQAPAEGNYNLALSAYVTLGXGCDAKSNIKLKVMKRSRAGTRGGFAAD
ETPAMEDGIEEDEEEEEEDFDDYESEYSEDEDDTKETKSKGAVANGSAHNKGNSSGSDESGSEAD
Predicted Coding Sequence 
XXGGGGCATGGATGGCTAAGACCTGCAATAGGAGTGGTGGAACTGTCTCAGAGTATTGTTCAAGCAGTACCTCTCAGCGCAAGGAAAGCA
GCAGGTGGATCCAGTGAAGGGTATGCACCATTTTTGCAGCTGCCACACTTTAGCGAGGCTGTCGTTAAAAAGATAGCAAGAAAGAAAGTT
CGTACATTTCAAGACTTCCGTGACATGACCCCGGATGAACGTGCTGATCTGCTGACTCAAGTTGCTGGGTTCTCCAATGGTGAATCCCAC
GATGTGGAGATGGTTCTTGAAATGATGCCTTCAGTGACAATTGATATCACATGTGAGACTGAAGGTGAGGAGGGAATTCAAGAGGGTGAC
ATCGTTACCATGCATGCTTGGGTCACTCTTAACCGTGGTAGTGGCTTGATACGCGCCCTTCCACATTGTCCATATTTTCCTTTTGACAAA
GAGGAGAATTTCTGGCTGATGCTTGCGGACTCCTTTTCGAATGATGTGTGGCTCTCTCAGAAGGTTAGTTTCATGGATGAAGCTACATCG
ATAATTGCTGTATCAAAAACAATTCAGGAGTCAAAGGAAGGGTCTGGTGCAAGTGCAAGGGAAATAAATGTTGCTGTTAAAGAAGCAATT
GAGAAAGTGAAAAATGGTTCAAGACTGGTAATGGGGAAGTTCCAAGCTCCAGCTGAAGGGAACTACAACTTGGCTCTTTCTGCTTATGTG
ACTCTTGGAXTTGGTTGTGATGCAAAGTCGAATATAAAGTTAAAGGTTATGAAACGTAGCAGAGCTGGAACCAGAGGTGGTTTCGCAGCA
GATGAGACTCCTGCCATGGAGGATGGAATTGAGGAGGACGAGGAAGAAGAAGAAGAGGATTTCGATGATTATGAAAGTGAATACAGCGAA
GATGAAGACGATACAAAGGAAACAAAGAGTAAAGGAGCTGTGGCCAATGGCTCTGCCCATAACAAGGGCAACAGTTCAGGTTCTGATGAA
TCTGGTTCAGAAGCCGACTAA\
Edits in Original Sequence 
(5')XXGGGGCATGGATGGCTAAGACCTGCAATAGGAGTGGTGGAACTGTCTCAGAGTATTGTTCAAGCAGTACCTCTCAGCGCAAGGAA
AGCAGCAGGTGGATCCAGTGAAGGGTATGCACCATTTTTGCAGCTGCCACACTTTAGCGAGGCTGTCGTTAAAAAGATAGCAAGAAAGAA
AGTTCGTACATTTCAAGACTTCCGTGACATGACCCCGGATGAACGTGCTGATCTGCTGACTCAAGTTGCTGGGTTCTCCAATGGTGAATC
CCACGATGTGGAGATGGTTCTTGAAATGATGCCTTCAGTGACAATTGATATCACATGTGAGACTGAAGGTGAGGAGGGAATTCAAGAGGG
TGACATCGTTACCATGCATGCTTGGGTCACTCTTAACCGTGGTAGTGGCTTGATACGCGCCCTTCCACATTGTCCATATTTTCCTTTTGA
CAAAGAGGAGAATTTCTGGCTGATGCTTGCGGACTCCTTTTCGAATGATGTGTGGCTCTCTCAGAAGGTTAGTTTCATGGATGAAGCTAC
ATCGATAATTGCTGTATCAAAAACAATTCAGGAGTCAAAGGAAGGGTCTGGTGCAAGTGCAAGGGAAATAAATGTTGCTGTTAAAGAAGC
AATTGAGAAAGTGAAAAATGGTTCAAGACTGGTAATGGGGAAGTTCCAAGCTCCAGCTGAAGGGAACTACAACTTGaGCTCTTTCTGCTT
ATGTGACTCTTGGAXTTGGTTGTGATGCAAAGTCGAATATAAAGTTAAAGGTTATGAAACGTAGCAGAGCTGGAACCAGAGGTGGTTTCG
CAGCAGATGAGACTCCTGCCATGGAGGATGGAATTGAGGAGGACGAGGAAGAAGAAGAAGAGGATTTCGATGATTATGAAAGTGAATACA
GCGAAGATGAAGACGATACAAAGGAAACAAAGAGTAAAGGAGCTGTGGCCAATGGCTCTGCCCATAACAAGGGCAACAGTTCAGGTTCTG
ATGAATCTGGTTCAGAAGCCGACTAA\(3')CTTCCTTTCTTGGCTAGTTTTTGTTCTCCTAATTTCCCCGTTGACATGATATTCCAATT
CTCCGGGGAGAAGACAAGACGAAACCAGTGAGAAAACATCCTCTCACTCCAAACGTTTGGGGAACTGGGGTCGTGGAGAGGCAGGTAAGA
AGAAGAGTATTTAATAGTGTTTTATCCTCCTTTACATACTTTGGACCGTCTTTCTTCCGTTGATATACTTAGAACAGTTAGTACTGTAAT
TTGACATGAATAATAGCATTGTACTCTTTATAGAGCTTAAATTAGTCCTTTTTGGTCCGACTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan