Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U223195

Score 
118
Direction 
Forward
Predicted Peptide Sequence 
MRKVWNFLQDLQHRVSSWGVDCETIGXLISLLIADHLGCLIYAQVRDFDKIXGIIVFLQVLDCLDHLGELIIAVSCKGMVTSTWKKYVYP
CWKPTLDNEGENSSSRGGDPGGSVDGLWWYKDLGHHVNGEFSMAVIQANNILEDQSQLESGSMSLFESGPQGTFXEYMMAMXVPKLPGL
Predicted Coding Sequence 
ATGCGCAAAGTCTGGAACTTTTTGCAAGATTTACAGCATAGGGTCTCAAGCTGGGGTGTTGATTGTGAAACAATTGGTGXTTTGATTAGT
CTTTTGATTGCTGATCATTTGGGTTGCTTGATATATGCACAAGTACGGGACTTTGACAAGATTXTAGGAATAATTGTGTTTTTGCAAGTA
CTTGATTGCCTAGACCATTTGGGTGAGTTGATAATAGCAGTATCATGCAAAGGTATGGTGACAAGTACATGGAAAAAGTATGTATACCCT
TGTTGGAAGCCTACATTAGATAATGAAGGTGAAAATAGCAGCAGTAGAGGAGGAGACCCTGGCGGAAGTGTTGATGGATTGTGGTGGTAT
AAAGATTTGGGGCACCATGTTAACGGGGAGTTCTCGATGGCTGTAATTCAAGCGAATAATATATTGGAGGATCAGAGCCAGCTTGAATCG
GGATCAATGAGTTTGTTTGAATCAGGTCCTCAGGGCACCTTTGANGAATATATGATGGCCATGCANGTGCCGAAGCTGCCCGGTTTATAA
\
Edits in Original Sequence 
CCCACCCCCCTCTCTCTCCCTCCTTCTATCACCCTTTTCCACATTGTAAAGAAACAATTTTTTTTCTCTTTGTCGCAAGAGAAAATCCAT
TCTTTTTTATTTTGTCAAAATCTGAGTTAAGGGGGGTCTTCCATTGCCACACCTAATTGGAAATCTCTGATGCAAGGCTTTGGGTAAATA
TTCTATTTAGTTAGCTAATGCTTTCCGGGTATGCAGATTAACTGTATGCATTTCTAGATAT
(5')ATGCGCAAAGTCTGGAACTTTTTGC
AAGATTTACAGCATAGGGTCTCAAGCTGGGGTGTTGATTGTGAAACAATTGGTGXTTTGATTAGTCTTTTGATTGCtTGATCATTTGGGT
TGCTTGATATATGCACAAGTACGGGACTTTGACAAGATTXTAGGAATAATTGTGTTTTTGCAAGTACTTGATTGCCTAGACCATTTGGGT
GAGTTGATAATAGCAGTATCATGCAAAGGTATGGTGACAAGTACATGGAAAAAGTATGTATACCCTTGTTGGAAGCCTACATTAGATAAT
GAAGGTGAAAATAGCAGCAGTAGAGGAGGAGACCCTGGCGGAAGTGTTGATGGATTGTGGTGGTATAAAGATTTGGGGCACCATGTTAAC
GGGGAGTTCTCGATGGCTGTAATTCAAGCGAATAATATATTGGAGGATCAGAGCCAGCTTGAATCGGGATCAATGAGTTTGTTTGAATCA
GGTCCTCAGGGCACCTTTGtANGAATATATGATGGCCATGCANGTGCCGAAGCTGCCCGGTTTATAA\(3')AATGGTCGCCTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan