ESTScan Details for Unigene SGN-U223237

Score 
512
Direction 
Forward
Predicted Peptide Sequence 
KDXNIGVIGLGGLGHLAIKFAKAFGHHVTVISTSLSKEKEAKTKLGADDFIVSSNPQQMKSRHRSLDFILDTVSANHSLGPYLELLKIKG
TFVIVGAPDKPMDLPSFPLIFGKRTVKGSMIGSIKETQEMMDICGKFNIMCDIEIITPHQINEAYERIEKNDIKYRFVIDIAGQSSKL
Predicted Coding Sequence 
AAAGACAAXAATATAGGAGTCATTGGTTTGGGAGGATTAGGTCATTTGGCTATTAAATTTGCAAAAGCTTTTGGACATCATGTCACTGTC
ATAAGCACTTCTTTATCAAAAGAAAAAGAAGCCAAAACCAAATTAGGTGCTGATGATTTCATTGTTAGCTCTAATCCACAACAAATGAAG
TCAAGGCATAGGAGTTTGGACTTCATATTGGACACAGTCTCAGCCAATCACTCTCTTGGGCCTTACTTGGAATTGCTTAAAATTAAAGGA
ACTTTTGTGATAGTGGGTGCACCAGATAAGCCCATGGACCTTCCATCATTTCCATTAATATTTGGTAAAAGAACAGTGAAAGGGAGCATG
ATTGGAAGTATAAAAGAAACACAAGAAATGATGGACATTTGTGGGAAGTTCAACATCATGTGTGACATAGAGATAATCACACCTCATCAG
ATAAATGAAGCTTATGAAAGAATTGAGAAGAATGATATTAAGTATCGCTTTGTGATCGACATTGCTGGTCAATCATCGAAACTTTAA\
Edits in Original Sequence 
(5')AAAGACAAXAATATAGGAGTCATTGGTTTGGGAGGATTAGGTCATTTGGCTATTAAATTTGCAAAAGCTTTTGGACATCATGTCAC
TGTCATAAGCACTTCTTTATCAAAAGAAAAAGAAGCCAAAACCAAATTAGGTGCTGATGATTTCATTGTTAGCTCTAATCCACAACAAAT
GAAGTCAAGGCATAGGAGTTTGGACTTCATATTGGACACAGTCTCAGCCAATCACTCTCTTGGGCCTTACTTGGAATTGCTTAAAATTAA
AGGAACTTTTGTGATAGTGGGTGCACCAGATAAGCCCATGGACCTTCCATCATTTCCATTAATATTTGGTAAAAGAACAGTGAAAGGGAG
CATGATTGGAAGTATAAAAGAAACACAAGAAATGATGGACATTTGTGGGAAGTTCAACATCATGTGTGACATAGAGATAATCACACCTCA
TCAGATAAATGAAGCTTATGAAAGAATTGAGAAGAATGATATTAAGTATCGCTTTGTGATCGACATTGCTGGTCAATCATCGAAACTTTA
A\(3')GTTCTTTAGGGAACTTTTCGAGTTTTAAGTATCGATATATTGAGTTGGATGAGTATTTCATGTACTAGGTATGCTTATTTATAA
GTATGAGTTGAATACTTTGTTTTTGTGCTTTGGTACACACTTGTAAATAATTACCTTTTGGGTTTACCAGTGTTATGGGCTTCAGCCCAT
ATACCGTATTGGGCTTGATTCTACATGATAGATCGGAAGGACAATCGTATATGTGGCCCAATGATGTGTAGTCTCTTGGGCTTAGACTTA
TATTTCATCAACTTCATAATATAGCACCAAAGCTAATAGGGAAAACAAAGCATGTTCTAGTTACTTCTCACTATTCTACGACAAATAAAG
AATTTAACGATGTTATTATATTATATTTATCATAATAAATAATATGAGTATTTATAATCAAAAAAAAAAAAAAAAACTCGAGACTATTCT
CTCCTCAAGTTTTTTTTTTTTTTTTTTTTTTTTTTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan