ESTScan Details for Unigene SGN-U223277

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
YAKAITKSSSKTAEGDEKKEIKLDVIAYAVLIDGFCKRRDMKSASELFDEILQVGISPNLFVYNSMMSGFINVNNMEAALVLRDKMINEG
VPCDLKTYTTLIDGLLKDGKIDLASHLFTEMLGKGIMPDDITYTVLVHGLSNKGQVENAHKILEEMYKKSMTPSVLIYNTLIAGYFKEGN
LQEAFXLHDEMLDKGLKPDDATYDILISGKLKDNSFGRGXFNATMNQIPLAICSRDTLAVTAVCKVDNFNVWGPMKAFSSSSRAPRRWEI
RKTFTGKTSTPSTKATNSRSSSATGTIKTQKLKGTHPWFVVKFAIGTTGPGPLEAYKGPLHRHVIAQEIITNFSYRNSNGKYSSPXNPKV
DDSTGAKIWERCKTKMQQ
Predicted Coding Sequence 
TATGCAAAAGCAATAACAAAATCTAGCTCTAAAACTGCTGAAGGAGATGAGAAAAAAGAAATTAAGTTAGATGTCATTGCATACGCTGTT
CTTATAGATGGGTTTTGCAAAAGAAGAGATATGAAAAGTGCTTCTGAACTTTTTGATGAAATTCTTCAAGTTGGTATCTCTCCTAACCTA
TTTGTTTATAATAGCATGATGAGTGGGTTTATAAATGTAAATAATATGGAAGCAGCACTAGTCTTGCGTGATAAGATGATCAATGAAGGC
GTTCCATGTGATCTGAAAACATACACCACATTGATTGATGGGCTTTTGAAGGATGGAAAAATAGATCTGGCGTCTCATTTGTTTACTGAG
ATGCTTGGAAAGGGTATAATGCCTGATGACATCACATATACTGTTCTTGTACATGGTCTTTCCAATAAAGGCCAGGTTGAGAATGCACAC
AAAATCTTAGAGGAGATGTATAAAAAGAGTATGACTCCTAGTGTTCTGATTTATAATACACTAATTGCTGGATACTTCAAGGAGGGAAAT
TTGCAAGAGGCATTTANGTTGCATGATGAGATGCTTGACAAAGGTCTTAAGCCCGATGATGCGACCTATGATATTCTTATAAGCGGAAAG
TTGAAAGATAATAGTTTCGGTCGTGGTAGXTTCAATGCCACAATGAACCAGATACCCTTAGCAATTTGTTCACGAGATACATTGGCTGTC
ACTGCTGTCTGCAAGGTCGACAACTTTAATGTTTGGGGTCCAATGAAGGCTTTCTCTTCGTCATCTCGAGCCCCTCGAAGGTGGGAAATA
AGGAAGACATTTACTGGTAAGACAAGCACTCCAAGTACTAAAGCAACCAACTCCAGGAGTAGTAGTGCAACAGGAACAATTAAAACCCAA
AAGTTGAAGGGTACACATCCATGGTTTGTTGTCAAGTTTGCTATTGGAACCACTGGTCCTGGACCACTTGAGGCCTACAAGGGTCCTTTG
CACCGCCATGTCATCGCACAAGAAATTATAACTAATTTTTCCTATCGTAACTCGAATGGTAAGTACTCTTCACCTTTXAACCCTAAAGTT
GACGATTCGACTGGAGCTAAAATATGGGAGAGGTGTAAAACAAAAATGCAACAATGA\
Edits in Original Sequence 
(5')TATGCAAAAGCAATAACAtAAATCTAGCTCTAAAACTGCTGAAGGAGATGAGAAAtAAAGAAATTAAGTTAGATGTCATTGCATAC
GCTGTTCTTATAGATGGGTTTTGCAAAAGAAGAGATATGAAAAGTGCTTCTGAACTTTTTGATGAAATTCTTCAAGTTGGTATCTCTCCT
AACCTATTTGTTTATAATAGCATGATGAGTGGGTTTATAAATGTAAATAATATGGAAGCAGCACTAGTCTTGCGTGATAAGATGATCAAT
GAAGGCGTTCCATGTGATCTGAAAACATACACCACATTGATTGATGGGCTTTTGAAGGATGGAAAAATAGATCTGGCGTCTCATTTGTTT
ACTGAGATGCTTGGAAAGGGTATAATGCCTGATGACATCACATATACTGTTCTTGTACATGGTCTTTCCAATAAAGGCCAGGTTGAGAAT
GCACACAAAATCTTAGAGGAGATGTATAAAAAGAGTATGACTCCTAGTGTTCTGATTTATAATACACTAATTGCTGGATACTTCAAGGAG
GGAAATTTGCAAGAGGCATTTANGTTGCATGATGAGATGCTTGACAAAGGTCTTAAGCCCGATGATGCGACCTATGATATTCTTATAAGC
GGAAAGTTGAAAGATAATAGTTTCGGTCGTGGTAGXTTCAATGCCACAATGAACCAGATACCCTTAGCAATTTGTTCACGAGATACATTG
GCTGTCACTGCTGTCTGCAAGGTCGACAACTTTAATGTTTGGGGTCCAATGAAGtGCTTTCTCTTCGTCATCTCGAGCCCCTCGAAGGTG
GGAAATAAGGAAGACATTTACTGGTAAGACAAGCACTCCAAGTACTAAAGCAACCAACTCCAGGAGTAGTAGTGCAACAGGAACAATTAA
AACCCAAAtAGTTGAAGGGTACACATCCATGGTTTGTTGTCAAGTTTGCTATTGGAACCACTGGTCCTGGACCAtCTTGAGGCCTACAAG
GGTCCTTTGCACCtGCCATGTCATCGCACAAGAAATTATAACTAATTTTTCCTATCGTAACTCGAATGGTAAGTACTCTTCACCTTTXAA
CCCTAAAGTTGACGATTCGACTGGAGCTAAAATATGGGAGAGGTGTAAAACAAAAATGCAACAATGA\(3')TGACTCGTATATTTCTGG
TGGCTGAAACTCGAGATTTTTTATTGAGTGCGAAGGAGTATCATTTCTTTAATATAAAATAAAAAGTTAAGCACGTAGAAATCGATTATA
GAATATTCTACTGAAAGAATAAGTGTTTCTCGCTCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan