Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U223313

Score 
324
Direction 
Reverse
Predicted Peptide Sequence 
NNTCVERSRERDIXDACAQVLQKQIRKIKGVECVTTDIEKSQVIIKGFNIDPEKLTKEVNKRSGKQASLVNNIIQEKEEEEEKEEEKEEY
IIKDYNLAQKYYNNNMEYYANYSPQIFSDNNPNACSIM
Predicted Coding Sequence 
XXAAATAACACTTGTGTTGAACGTTCAAGAGAGAGAGACATTGXTGATGCTTGTGCTCAAGTTCTTCAGAAGCAAATCCGCAAAATCAAA
GGTGTAGAATGTGTTACGACAGATATTGAAAAAAGTCAAGTAATTATAAAAGGTTTCAATATCGACCCAGAAAAGTTAACTAAAGAAGTG
AATAAGAGAAGCGGAAAACAAGCTTCACTCGTAAATAATATTATTCAAGAGAAAGAAGAAGAAGAAGAGAAGGAGGAAGAAAAAGAAGAA
TATATTATTAAGGATTATAATTTAGCTCAAAAGTACTACAACAACAACATGGAGTACTACGCTAATTATTCTCCTCAAATTTTCAGTGAT
AACAATCCTAATGCTTGCTCTATCATGTAA\
Edits in Original Sequence 
(5')XXAAATAACACTTGTGTTGAACGTTCAAGAGAGAGAGACATTGXTGATGCTTGTGCTCAAGTTCTTCAGAAGCAAATCCGCAAAAT
CAAAGGTGTAGAATGTGTTACGACAGATATTGAAAAAAGTCAAGTAATTATAAAAGGTTTCAATATCGACCCAGAAAAGTTAACTAAAGA
AGTGAATAAGAGAAGCGGAAAACAAGCTTCACTCGTAAATAATATTATTCAAGAGAAAGAAGAAGAAGAAGAGAAGGAGGAAGAAAAAGA
AGAATATATTATTAAGGATTATAATTTAGCTCAAAAGTACTACAACAACAACATGGAGTACTACGCTAATTATTCTCCTCAAATTTTCAG
TGATAACAATCCTAATGCTTGCTCTATCATGTAA\(3')CTTAATTAATATTCACGCTAATTTAAGAATGAAAAAAAAACTTCACCAATT
TCAATATGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan