ESTScan Details for Unigene SGN-U223314

Score 
354
Direction 
Reverse
Predicted Peptide Sequence 
HGHWVNSLALSTEYVFRSGAFDHTNKHFASXEEMKKVALERYNKMRGNAPERLVSGSDDFTMFLWEPAVSKHPKTRMTGHQQLVNHVYFS
PDGQWIASASFDKSVKLWNGTTGKFVAAFRGHVGPVYQIRLKFAIKLKSSITSTATVSYYPCVLHSWSADSRLLLSGSKDSTLKVWDIRT
KKLKQDLPGHADEVFAVDWSPDGEKVASGGKDRVLKLWMGRNKGDSTPIPMKLLFLPGKFKAPTFIY
Predicted Coding Sequence 
XGTCATGGACATTGGGTAAATTCTCTAGCATTGAGCACTGAATATGTCTTTCGAAGTGGAGCTTTTGATCACACTAATAAACACTTCGCA
TCTCNTGAGGAAATGAAAAAGGTAGCACTTGAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCAGGATCAGATGAT
TTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGTTAATCACGTTTATTTT
TCTCCGGATGGTCAATGGATAGCAAGTGCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAAATTTGTTGCTGCATTC
CGAGGCCATGTTGGACCTGTTTATCAGATAAGGTTAAAATTTGCCATAAAACTCAAATCTTCCATTACTTCAACAGCAACTGTTAGTTAC
TATCCTTGTGTTTTGCACAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGATTCAACCTTGAAGGTTTGGGATATCCGG
ACAAAAAAATTGAAACAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAGTCCAGACGGCGAAAAAGTAGCATCTGGT
GGTAAAGATAGAGTTCTGAAGCTATGGATGGGAAGAAACAAGGGTGACTCCACCCCTATACCAATGAAGCTCTTGTTTTTGCCTGGAAAA
TTCAAGGCCCCTACTTTTATTTATTAG\
Edits in Original Sequence 
(5')XGTCATGGACATTGGGTAAATTCTCTAGCATTGAGCACTGAATATGTCTTTCGAAGTGGAGCTTTTGATCACACTAATAAACACTT
CGCATCTCNTGAGGAAATGAAAAAGGTAGCACTTGAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCAGGATCAGA
TGATTTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGTTAATCACGTTTA
TTTTTCTCCGGATGGTCAATGGATAGCAAGTGCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAAATTTGTTGCTGC
ATTCCGAGGCCATGTTGGACCTGTTTATCAGATAAGGTTAAAATTTGCCATAAAACTCAAATCTTCCATTACTTCAACAGtCAACTGTTA
GTTACTATCCTTGTGTTTTGCACAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGATTCAACCTTGAAGGTTTGGGATA
TCCGGACAAAAAAATTGAAACAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAGTCCAGACGGCGAAAAAGTAGCAT
CTGGTGGTAAAGATAGAGTTCTGAAGCTATGGATGGGAtAGAAACAAGGGTGACTCCACCCCTATACCAATGAAGCTCTTGTTTTTaGCC
TGGAAAATTCAAGGCCCCTACTTTTATTTATTAG\(3')ATATATAAAATATGTAATTCAAGTAGTAATCGCCATTCTTATTATTATTAA
TATTAATGATATACGTGAGCTTTTTACCAGCCATTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan