ESTScan Details for Unigene SGN-U223389

Score 
436
Direction 
Forward
Predicted Peptide Sequence 
AVFLRGKGTSKRGMEMMNYQVGRSSYQDSLKVLEADIQYANTLAAAIPRERSGARLQMKLTYNGLAPXVSVFAPLGSSSCTCLLPGYMNF
FHVLIYKVRTDGRPRISRHGRRATINDFYGVILPSLQQLHSNLVELDDCKVVNHGIGSSQEKVKGDSKFSNFEAEEKMNVEYAWSLVTKW
SYQIAAMQCALIAIAIGIQDPNPAPFAXGNLKRVKSRDLWVLTCNDEVVDPETVSKEDLLHFYLYVNSLPKDSPDAVXLDVL
Predicted Coding Sequence 
GCAGTTTTCTTGAGGGGTAAAGGCACCTCAAAGAGGGGGATGGAGATGATGAATTATCAGGTTGGAAGGAGTTCTTATCAGGATTCCTTG
AAAGTTTTGGAGGCTGATATTCAGTATGCTAATACTCTGGCTGCTGCAATTCCAAGAGAAAGGAGTGGAGCACGTCTTCAAATGAAACTG
ACCTACAATGGATTGGCTCCTGXTGTTTCTGTTTTTGCTCCGTTGGGTAGTAGTTCATGCACTTGTCTACTTCCTGGATATATGAATTTC
TTTCATGTCCTCATTTACAAAGTGCGTACAGATGGGAGACCAAGAATATCTAGACACGGAAGAAGAGCAACTATCAACGACTTTTATGGT
GTTATACTGCCATCACTACAGCAGCTACATTCTAACTTGGTGGAGCTGGACGATTGTAAAGTCGTAAATCATGGCATAGGAAGTTCTCAA
GAGAAAGTGAAAGGAGACTCCAAATTTTCAAACTTTGAAGCAGAGGAGAAGATGAATGTGGAATATGCTTGGAGCCTTGTAACAAAATGG
TCTTACCAAATTGCTGCCATGCAATGTGCATTAATTGCTATCGCGATTGGAATACAAGATCCGAATCCTGCCCCTTTTGCCGXTGGTAAT
TTGAAGAGAGTTAAATCAAGAGACTTGTGGGTCCTCACCTGCAATGATGAAGTTGTTGATCCCGAGACTGTTTCCAAAGAGGATTTATTG
CATTTCTATTTGTATGTTAACAGTCTGCCTAAGGATTCTCCTGATGCXGTTGNTCTTGATGTATTATGA\
Edits in Original Sequence 
TTCAACCATTATATTTTCTCTATTACCAAAAAAAAAACTTAGAAAGCTGTCCTATTCAAAGCCGACTTTTTTTTTTAGAAAAAAAGTGAT
GTTTTTTTCTTAATAAAGATAGTGTTCTTGAAAAAGGGTGGAAGAGATCAAAAGGGGTATCTTGTTTTCTTGAAAAATTGTGTTATTTTG
GCACAAAAACAAGATTAGACATATTGGGGTTTTAGTTTTTTTTGTGTAGAAGGAAGACTTTGCTTTTGTCAATATTTGTTTGTACAAGAA
AACATAAAAA
(5')GCAGTTTTCTTGAGGGGTAAAGGCACCTCAAAGAGGGGGATGGAGATGATGAATTATCAGGTTGGAAGGAGTTCTT
ATCAGGATTCCTTGAAAGTTTTGGAGGCTGATATTCAGTATGCTAATACTCTGGCTGCTGCAATTCCAAGAGAAAGGAGTGGAGCACGTC
TTCAAATGAAACTGACCTACAATGGATTGGCTCCTGXTGTTTCTGTTTTTGCTCCGTTGGGTAGaTAGTTCATGCACTTGTCTACTTCCT
GGATATATGAATTTCTTTCATGTCCTCATTTACAAAGTGCGTACAGATGGGAGACCAAGAATATCTAGACACGGAAGAAGAGCAACTATC
AACGACTTTTATGGTGTTATACTGCCATCACTACAGCAGCTACATTCTAACTTGGTGGAGCTGGACGATTGTAAAGTCGTAAATCATGGC
ATAGGAAGTTCTCAAGAGAAAGTGAAAGGAGACTCCAAATTTTCAAACTTTGAAGCAGAGaGAGAAGATGAATGTGGAATATGCTTGGAG
CCTTGTAACAAAATGGTCTTACCAAATTGCTGCCATGCAATGTGCATTAATTGCTATCGCGATTGGAATACAAGATCCGAATCCTGCCCC
TTTTGCCGXTGGTAATTTGAAGAGAGTTAAATCAAGAGACTTGTGGGTCCTCACCTGCAATGATGAAGTTGTTGATCCCGAGACTGTTTC
CAAAGAGGATTTATTGCATTTCTATTTGTATGTTAACAGTCTGCCTAAGGATTCTCCTGATGCXGTTGNTCTTGATGTATTATGA\(3')
ATATCTAATATGACATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan