ESTScan Details for Unigene SGN-U223410

Score 
9
Direction 
Forward
Predicted Peptide Sequence 
VMNQNEENAAVDGTSRYRWWAAASTGQLLWGIYAYRRGFAGECRMMPLKAFAVASLFVGATASASMASLRACGXPLGGRHEGCRGKYKNR
TWVDTEGHEKTDYFRALSRISSLKTIDQGRSPSV
Predicted Coding Sequence 
XXGGTAATGAACCAAAACGAAGAAAACGCCGCTGTTGACGGCACGTCCAGATACCGATGGTGGGCAGCCGCGAGTACAGGTCAGTTACTA
TGGGGAATTTACGCTTATAGGAGAGGTTTTGCCGGCGAATGTCGAATGATGCCACTTAAAGCCTTCGCCGTCGCCTCGCTTTTCGTCGGC
GCCACCGCCTCCGCCTCTATGGCTTCTCTTCGCGCCTGCGGCXATCCACTCGGTGGAAGACATGAAGGTTGTCGGGGAAAGTATAAGAAC
CGGACTTGGGTTGACACXGAAGGGCACGAGAAGACTGACTACTTTAGAGCACTATCGCGAATCAGTAGCCTTAAGACGATTGACCAAGGA
AGATCTCCATCTGTGTAG\
Edits in Original Sequence 
(5')XXGGTAATGAACCAAAACGAAGAAAACGCCGCTGTTGACGGCACGTCCAGATACCGATGGTGGGCAGCCGCGAGTACAGGTCAGTT
ACTATGGGGAATTTACGCTTATAGGAGAGGTTTTGCCGGCGAATGTCGAATGATGCCACTTAAAGCCTTCGCCGTCGCCTCGCTTTTCGT
CGGCGCCACCGCCTCCGCCTCTATGGCTTCTCTTCGCGCCTGCGGCXATCCACTCGGTGGAAGACATGAAGGTTGTCGGGGAAAGTATAA
GAACCGGACTTGGGTTGACACXGAAGGGCACGAGAAGACTGACTACTTTAGAGCACTATCGCGAATCAGTAGCCTTAAGACGATTGACCA
AGGAAGATCTCCATCTGTGTAG\(3')TTTCTTGCTAAACTCAATTCCAAGGGGAGCACATATCCGAAAGGGTATCTACCCCAGGCATGT
ACCTAAGTAATAAAATGGATGACATTTGTTTTTCTATATACAAGGTTAATTTATACTTAGTGGATAAGTATATCCAACTATGCACTGGCA
TATTGTATCATATCAACTGCATCTACGACAGCTACAAGAGCATCAGTTGTTTGGGTTTAAAAAAAAAAAAAAAAAAAAAACGCGAGACTA
GTTCTCTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan