ESTScan Details for Unigene SGN-U223436

Score 
800
Direction 
Forward
Predicted Peptide Sequence 
MASEQMKPVASLLLVLNFCMYVVVLGIGGWAMNFAIDNGFVIGPGMNLPAHFSPIYFPIGNAATGFFVVFALIAGVVGVASVLSGLNHIR
HWNIDSLPSAASAATIAWSLTVLAMGFAWKEIELNYRNSKLKTMEAFMIILSFTQLVYIAAIHGAXIKEINELRR
Predicted Coding Sequence 
ATGGCTAGTGAGCAGATGAAACCTGTTGCATCTTTGCTTTTGGTCCTTAATTTCTGCATGTATGTTGTTGTTTTAGGTATTGGTGGTTGG
GCTATGAACTTTGCCATTGATAATGGTTTTGTCATTGGTCCAGGAATGAATCTTCCAGCACATTTCTCACCAATTTACTTCCCAATTGGA
AATGCTGCCACTGGATTCTTTGTTGTATTTGCTTTGATAGCAGGTGTGGTTGGAGTTGCATCTGTTCTCTCTGGACTTAACCACATTCGC
CATTGGAACATCGATAGCTTACCATCTGCTGCTTCTGCTGCTACAATAGCCTGGAGTCTTACAGTCCTTGCCATGGGCTTTGCTTGGAAA
GAAATTGAACTCAACTACAGGAATTCCAAATTGAAAACAATGGAGGCATTCATGATAATTCTATCATTTACTCAACTGGTATACATAGCT
GCCATTCATGGTGCTXTCATCAAGGAGATAAATGAGCTTCGAAGATAA\
Edits in Original Sequence 
ACATAATCTTCTTAGCCTTTACAACACAAAAAAAGAAAAAAACTTATTCAGTTTTCATCAAAAAGAGGTTTCAAGCCTTACTATCATTAT
CATTTTCAAGAACCAAGA
(5')ATGGCTAGTGAGCAGATGAAACCTGTTGCATCTTTGCTTTTGGTCCTTAATTTCTGCATGTATGTTGT
TGTTTTAGGTATTGGTGGTTGGGCTATGAACTTTGCCATTGATAATGGTTTTGTCATTGGTCCAGGAATGAATCTTCCAGCACATTTCTC
ACCAATTTACTTCCCAATTGGAAATGCTGCCACTGGATTCTTTGTTGTATTTGCTTTGATAGCAGGTGTGGTTGGAGTTGCATCTGTTCT
CTCTGGACTTAACCACATTCGCCATTGGAACATCGATAGCTTACCATCTGCTGCTTCTGCTGCTACAATAGCCTGGAGTCTTACAGTCCT
TGCCATGGGCTTTGCTTGGAAAGAAATTGAACTCAACTACAGGAATTCCAAATTGAAAACAATGGAGGCATTCATGATAATTCTATCATT
TACTCAACTGGTATACATAGCTGCCATTCATGGTGCTXTCATCAAGGAGATAAATGAGCTTCGAAGATAA\(3')ATCGTATCGTGTGAA
ATTTATTGATTGAGACTGTTGTTTCCTTTTCTTTTTTTGTTTTAACAATTGTGTCATTGTATTTATTCATTATTGTGTACACAAAGTTGG
CCAGATGGCTGTTTGTATATCAACTATCTTCAGTATTCATATTGTAAGAAACAAATAAGTGATGTACCCTTCATTGGCTTTTTCCCAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan