ESTScan Details for Unigene SGN-U223446

Score 
367
Direction 
Forward
Predicted Peptide Sequence 
SHIPSKYSNTPPQTRITMDLLRGNSVGIPMSSSVGSLESQPKRLLALPACEDHIVPYATSKNLSQIKQRRYVIGKMNKLGERVDCLVKSI
REHVSLSPKLTETLKGKLSLGAKILQVGGLEKIFRQKFSVRDDEKLLNVSQCYLSTTAGPIAGLLFISTDKIAFCSERSIKLLSPTGKLL
RIYYKVTIPISKIMKAKESKNMQKPSQKYIQVITEDDFEFWFMGFLNHQKTLRYLQQQSPAQASYEDTFFFLMSSFFNVKRSCKNEFRDL
LKLCXLDPLLKGGLRFNLCALKS
Predicted Coding Sequence 
TCCCACATACCTTCAAAATACAGTAATACTCCACCTCAAACCAGAATCACAATGGACTTACTCCGTGGAAATTCGGTGGGTATTCCCATG
AGTTCATCAGTAGGTTCACTTGAAAGCCAGCCGAAAAGACTACTTGCCTTACCTGCTTGCGAAGACCATATCGTTCCATATGCAACTTCA
AAGAACTTGTCTCAAATTAAGCAGAGAAGATATGTCATTGGTAAGATGAACAAATTGGGAGAAAGGGTGGATTGTCTAGTAAAAAGCATC
CGCGAGCATGTGAGCCTAAGCCCGAAACTAACAGAAACTTTAAAGGGAAAATTGAGCCTTGGAGCAAAAATCCTTCAAGTAGGAGGGTTG
GAGAAAATATTCAGGCAGAAGTTCAGTGTTAGAGATGATGAAAAGCTATTGAATGTTTCTCAATGCTATTTATCAACGACAGCTGGTCCA
ATAGCAGGCCTTCTCTTCATCTCTACCGATAAGATTGCTTTCTGCAGCGAGAGATCAATAAAGCTCTTATCTCCAACTGGAAAGTTGCTT
AGAATCTACTATAAGGTAACCATCCCAATAAGTAAGATAATGAAAGCAAAAGAGAGCAAAAATATGCAAAAGCCATCACAGAAGTATATA
CAAGTAATTACAGAGGATGATTTTGAGTTCTGGTTTATGGGATTCCTCAATCATCAAAAGACACTGAGATATCTGCAGCAGCAATCTCCA
GCTCAAGCAAGTTATGAAGACACATTTTTTTTTCTAATGAGCTCGTTCTTCAATGTAAAACGTTCATGCAAAAACGAATTCAGGGATCTG
TTAAAACTTTGTAAXCTAGATCCATTGCTCAAAGGAGGCTTAAGGTTTAACCTTTGTGCCCTTAAGAGTTAA\
Edits in Original Sequence 
(5')TCCCACATACCTTCAAAATACAGTAATACTCCACCTCAAACCAGAATCACAATGGACTTACTCCGTGGAAATTCGGTGGGTATTCC
CATGAGTTCATCAGTAGGTTCACTTGAAAGCCAGCCGAAAAGACTACTTGCCTTACCTGCTTGCGAAGACCATATCGTTCCATATGCAAC
TTCAAAGAACTTGTCTCAAATTAAGCAGAGAAGATATGTCATTGGTAAGATGAACAAATTGGGAGAAAGGGTGGATTGTCTAGTAAAAAG
CATCCGCGAGCATGTGAGCCTAAGCCCGAAACTAACAGAAACTTTAAAGGGAAAATTGAGCCTTGGAGCAAAAATCCTTCAAGTAGGAGG
GTTGGAGAAAATATTCAGGCAGAAGTTCAGTGTTAGAGATGATGAAAAGCTATTGAATGTTTCTCAATGCTATTTATCAACGACAGCTGG
TCCAATAGCAGGCCTTCTCTTCATCTCTACCGATAAGATTGCTTTCTGCAGCGAGAGATCAATAAAGCTCTTATCTCCAACTGGAAAGTT
GCTTAGAATCTACTATAAGGTAACCATCCCAATAAGTAAGATAATGAAAGCAAAAGAGAGCAAAAATATGCAAAAGCCATCACAGAAGTA
TATACAAGTAATTACAGAGGATGATTTTGAGTTCTGGTTTATGGGATTCCTCAATCATCAAAAGACACTGAGATATCTGCAGCAgGCAAT
CTCCAGCTCAAGCAAGTTATGAAGACACATTTTTTTTTCTAATGAGCTCGTTCTTCAATGTAAAACGTTCATGCAAAAACGAATTCAGGG
ATCTGTTAAAACTTTGTAAXCTAGATCCATTGCTCAAAGGAGGCTTAAGGTTTAACCTTTGTGCCCTTAAGAGTTAA\(3')TGGGAATG
TATAGACTTTTTTTTCTCTAAAACTGGTAGCTTTTGTATAGACTTATTTTGTTTTTTGAGATAGCAAGAGATACGAATGTACAAATTTAT
TATAAAACTTGTGGAGATAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan