ESTScan Details for Unigene SGN-U223454

Score 
932
Direction 
Forward
Predicted Peptide Sequence 
AVWDPRTGSKTMKLKGHTDNIRALLIDSTGRFCISGSSDSMIRLWDLGQQRCVHSYAVHTDSVWSLASTPTFSHVYSGGRDLSLYLTDLA
TRESVLMCTKEHPILQLALHDDGIWVATTDSSVHRWAAEVRNPQKVFQRGGSFLAGNLSFSRARVSLEGSTPVPVYKEPSLSIPGTPGIV
QHEILNNRRHVLTKDTAGTVKLWEITRGTVIHNYGEVSFEKKKEELFEMVSIPAWFTVDTKLGNLSVHLDTPQCFSAEMYSADLHIPGKP
EDDKVNLARETLKGLLAHWLAKRKQRFGSQAFANGEAPAGKDVPTRNLTASKIEVDGSADNDAAVYPPFEFSAACPPSIITEGSQSGPWR
KKIT
Predicted Coding Sequence 
GCCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGAAGCTAAAAGGTCATACAGATAATATTAGGGCTCTTCTGATAGACTCCACTGGC
AGGTTCTGCATATCTGGATCCTCTGATTCCATGATTAGACTATGGGATCTAGGTCAGCAGCGTTGCGTGCATTCTTATGCTGTGCATACG
GATTCTGTATGGTCACTTGCTAGCACTCCTACGTTTAGTCATGTTTATAGTGGTGGAAGAGACCTATCTTTATACTTGACAGATTTGGCA
ACAAGGGAGAGTGTATTGATGTGCACAAAGGAACACCCCATTTTGCAGTTAGCATTGCATGATGATGGCATTTGGGTGGCCACAACTGAT
TCATCTGTACATAGGTGGGCTGCAGAAGTGCGTAATCCCCAGAAAGTTTTCCAAAGAGGGGGCTCATTCTTGGCTGGAAACTTGTCCTTT
TCCCGGGCAAGGGTTTCTCTAGAAGGATCTACACCTGTTCCTGTTTATAAAGAACCATCTCTTAGCATTCCTGGAACTCCAGGAATAGTG
CAGCATGAGATTTTGAACAACAGAAGACATGTCCTGACTAAGGATACTGCTGGAACAGTGAAGTTGTGGGAGATCACTAGAGGCACTGTG
ATTCACAACTATGGAGAGGTTTCATTTGAGAAGAAGAAAGAAGAACTTTTTGAGATGGTGAGCATCCCTGCATGGTTCACTGTGGACACT
AAGCTTGGAAACTTGTCTGTACATCTGGATACACCACAATGCTTTTCTGCTGAGATGTACTCTGCTGATCTCCACATTCCAGGGAAGCCT
GAAGATGACAAGGTTAATTTGGCACGAGAAACCCTTAAAGGGCTGTTGGCTCATTGGTTAGCAAAAAGAAAACAGAGATTTGGATCTCAA
GCTTTTGCCAATGGGGAAGCCCCAGCTGGAAAGGATGTACCTACAAGGAATCTGACCGCGTCAAAAATTGAAGTGGACGGTAGTGCTGAC
AATGATGCTGCAGTATATCCTCCCTTTGAATTTTCAGCAGCATGCCCTCCATCAATTATTACTGAGGGTTCTCAAAGTGGTCCATGGAGG
AAAAAGATTACX\
Edits in Original Sequence 
(5')GCgCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGAAGCTAAAAGGTCATACAGATAATATTAGGGCTCTTCTGATAGACTCCA
CTGGCAGGTTCTGCATATCTGGATCCTCTGATTCCATGATTAGACTATGGGATCTAGGTCAGCAGCGTTGCGTGCATTCTTATGCTGTGC
ATACGGATTCTGTATGGTCACTTGCTAGCACTCCTACGTTTAGTCATGTTTATAGTGGTGGAAGAGACCTATCTTTATACTTGACAGATT
TGGCAACAAGGGAGAGTGTATTGATGTGCACAAAGGAACACCCCATTTTGCAGTTAGCATTGCATGATGATGGCATTTGGGTGGCCACAA
CTGATTCATCTGTACATAGGTGGGCTGCAGAAGTGCGTAATCCCCAGAAAGTTTTCCAAAGAGGGGGCTCATTCTTGGCTGGAAACTTGT
CCTTTTCCCGGGCAAGGGTTTCTCTAGAAGGATCTACACCTGTTCCTGTTTATAAAGAACCATCTCTTAGCATTCCTGGAACTCCAGGAA
TAGTGCAGCATGAGATTTTGAACAACAGAAGACATGTCCTGACTAAGGATACTGCTGGAACAGTGAAGTTGTGGGAGATCACTAGAGGCA
CTGTGATTCACAACTATGGAGAGGTTTCATTTGAGAAGAAGAAAGAAGAACTTTTTGAGATGGTGAGCATCCCTGCATGGTTCACTGTGG
ACACTAAGCTTGGAAACTTGTCTGTACATCTGGATACACCACAATGCTTTTCTGCTGAGATGTACTCTGCTGATCTCCACATTCCAGGGA
AGCCTGAAGATGACAAGGTTAATTTGGCACGAGAAACCCTTAAAGGGCTGTTGGCTCATTGGTTAGCAAAAAGAAAACAGAGATTTGGAT
CTCAAGCTTTTGCCAATGGGGAAGCCCCAGCTGGAAAGGATGTACCTACAAGGAATCTGACCGCGTCAAAAATTGAAGTGGACGGTAGTG
CTGACAATGATGCTGCAGTATATCCTCCCTTTGAATTTTCAGCAGCATGCCCTCCATCAATTATTACTGAGGGTTCTCAAAGTGGTCCAT
GGAGGAAAAAGATTACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan