Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U223634

Score 
450
Direction 
Forward
Predicted Peptide Sequence 
MVEKGEKPTVISYGALLSALEKGKLYDEALQVWKHMIKVGIEPNLYAYTIMASIYTAQGKFNIVDSIIKEMVTTGVEPTVVTFNAIISGC
ARNGMESVAYEWFQRMKTQNITPNEVSYEVLIEALANDGKPRLAYELYVRALTEGLSLSTKAYDAVISSTQAYGASIDLSILGPRPPEKK
KRVQIRKSLSEFCHIADFPEEAGPLTGKKFXTAQTKGT
Predicted Coding Sequence 
ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAAGCTCTT
CAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAAGGGAAA
TTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGTGGATGT
GCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTATGAAGTG
CTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTTTCTACA
AAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAAAAAAAG
AAACGAGTGCAAATCAGGAAAAGTTTGTCTGAATTCTGTCATATAGCCGATTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAAAAAATTT
XTTACTGCTCAGACAAAAGGAACATGA\
Edits in Original Sequence 
(5')ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAAGC
TCTTCAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAAGG
GAAATTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGTGG
ATGTGCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTATGA
AGTGCTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTTTC
TACAAAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAAAA
AAAGAAACGAGTGCAAATCAGGAAAAGTTTGTCTGAATTCTGTCATATAGCCGATgTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAAAA
AATTTXTTACTGCTCAGACAAAAGGAACATGA\(3')TAAGCACAACTTTATATTGCTAGTGTGTGTAAGTATACAACTCATTGTTTATA
TGTTGTGCTGTTTTCAACAAAAAGTGTATGCTTCCTCTTGGGTAAAGCTACATTAGTTGATTGACTTTAAATGCAAAATCAGGCTTATCC
CAATTACCTTTTCACCTCTATCCTGGATTCAAGCATTCATTTTTTTTTTTGCACTTTCAATATATAAACCGCCCCATCATATTATTATCA
ATTTATACAATATGCCTCCCTTTAATTTGCGAATCAAATACAGTCATGCCTCCGAAAGTGTTTGTTCAAAACTCAACCTTGACAGAAAAC
ACTAGTTGATTTTTTCCCTTTGTCCTAGCTTTAGTGGATATAGTTTATTCATACTTATTGCTGGGGTGAAATGGCATGTACCAACTTTGC
TAATTTTGTTCCCTTTGTACTGAAAAAGTTGAAACCCTTCCTTTTGTACTGAAAAAGTTGAAACCCTTTAAAGTTGTTTCCATAGAATTT
CAGGCTGACAGGTAATTTGAGGAAGCATATTAATATTTTTTTTGTACAACTACCAAAAAGCTTGCTAGAATCAATTCCTTGACATATGTT
TGATGTAAGTATTTATTGAACTAAATTTTTTTGTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan