ESTScan Details for Unigene SGN-U223650

Score 
208
Direction 
Reverse
Predicted Peptide Sequence 
MHPTRQKRTADHKSQPNPDKKVKASELQTMWRQLNSKNHERHTQTLSDPCSFCWSMYAFFISSKTESFGTDEDTHLIPWLVCDTAKQXDI
VLPEAHSAYFXSISITFFECFLLHFTAQSFFNLLFDVIFSGFLHVSHYELILQLFTTPLFSNTLNPKTSLX
Predicted Coding Sequence 
ATGCACCCAACAAGGCAAAAACGTACTGCTGATCACAAATCACAGCCAAATCCTGATAAGAAAGTGAAGGCTTCTGAACTGCAGACAATG
TGGAGACAACTTAACTCGAAGAACCATGAAAGGCATACTCAAACTCTAAGTGATCCCTGTTCATTCTGTTGGAGCATGTATGCTTTCTTC
ATTTCTTCCAAAACAGAGTCATTCGGTACTGATGAAGACACTCATTTAATTCCTTGGCTTGTTTGCGACACTGCCAAACAAXCAGATATT
GTTCTTCCTGAGGCACACTCAGCGTATTTTGXTAGTATATCGATCACATTCTTTGAGTGCTTTCTGCTTCATTTTACTGCGCAGAGCTTC
TTCAACCTTCTTTTTGACGTGATTTTCTCTGGCTTCTTGCACGTATCCCATTACGAACTGATACTTCAACTCTTCACAACTCCTCTCTTC
TCCAACACCCTAAACCCTAAAACCTCACTTTGX\
Edits in Original Sequence 
GTCTCAGAATGACTTGCATACCTGAAACAAGGGGATAAACAAGTTCGCTCATCACCCAATTTGAAAATTAGTGACCAAGTGTAGCATGTA
TAACTTTAGAACCGCAAATTTATTCAATTTTCTGTGAGTTCCACCAAGAACTAA
(5')ATGCACCCAACAAGGCAAAAACGTACTGCTcG
ATCACAAATCACAGCCAAATCCTGATAAGAAAGTGAAGGcCTTCTGAACTGCAGACAATGTGGAGACAACTTAACTCGAAGAACCATGAA
AGGCATACTCAAACTCTAAGTGATCCCTGTTCATTCTGTTGGAGCATGTATGCTTTCTTCATTTCTTCCAAAACAGAGTCATTCGtGTAC
TGATGAAGACACTCATTTAATTCCTTGGCTTGTTTGCGACACTGCCAAACAAXCAGATATTGTTCTTCCTGAGGCACACTCAGCGTATTT
TGXTAGTATATCGATCACATTCTTTGAGTGCTTTCTGCTTCATTTTACTGCGCAGAGCTTCTTCAACCTTCTTTTTGACGTGATTTTCTC
TGGCTTCTTGCACGTATCCCATTACGAACTGATACTTCAACTCTTCACAACTCCTCTCTTCTCCAACACCCTAAACCCTAAAACCTCACT
TTGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan