ESTScan Details for Unigene SGN-U223662

Score 
320
Direction 
Reverse
Predicted Peptide Sequence 
SQRLSIMIDVACGXNISITDAPRPVIHCDLKPSNVLLDEDMVAHLSDFGISKLLGEDENDLYTKTLATFGYIAPEYGMDGLVSIKCDVYS
YGIMLLETFTRRKPSEFEGDLSLKQWVSYSLPEAVMNVVDANLVTPMDHRLQKKLDIVASIMKVALDCCVESPATRTNMKDVVGMLQKIK
IQLLAC
Predicted Coding Sequence 
XXCAGCCAGAGATTAAGCATTATGATAGATGTGGCATGTGGTNGGAATATCTCCATCACGGATGCTCCTCGCCCXGTGATTCACTGTGAT
CTAAAGCCTAGTAACGTCTTGCTGGATGAGGATATGGTTGCCCACCTAAGTGACTTTGGTATTTCAAAACTGCTCGGTGAAGACGAGAAC
GATTTATACACTAAAACCTTAGCAACATTTGGTTATATAGCACCGGAGTATGGAATGGATGGACTGGTGTCAATAAAATGTGATGTCTAT
AGTTATGGGATTATGTTGCTGGAAACATTTACTAGGAGAAAGCCTAGTGAGTTTGAGGGAGATCTTAGCTTGAAGCAATGGGTGAGTTAT
TCACTCCCAGAGGCAGTAATGAACGTTGTAGATGCCAATTTGGTAACACCAATGGATCATCGCTTACAGAAGAAGCTAGATATCGTTGCA
TCAATCATGAAAGTGGCATTAGATTGTTGTGTTGAATCTCCGGCAACAAGGACAAACATGAAAGATGTTGTAGGGATGCTACAGAAGATC
AAGATTCAACTTCTTGCATGTTGA\
Edits in Original Sequence 
(5')XXCAGCCAGAGATTAAGCATTATGATAGATGTGGCATGTGcGTNGGAATATCTCCATCACGGATGCTCCTCGCCCXGTGATTCACT
GTGATCTAAAGCCTAGTAACGTCTTGCTGGATGAGGATATGGTTGCCCACCTAAGTGACTTTGGTATTTCAAAACTGCTCGGTGAAGACG
AGAACGATTTATACACTAAAACCTTAGCAACATTTGGTTATATAGCACCGGAGTATGGAATGGATGGACTGGTGTCAATAAAATGTGATG
TCTATAGTTATGGGATTATGTTGCTGGAAACATTTACTAGGAGAAAGCCTAGTGAGTTTGAGGGAGATCTTAGCTTGAAGCAATGGGTGA
GTTATTCACTCCCAGAGGCAGTAATGAACGTTGTAGATGCCAATTTGGTAACACCAATGGATCATCGCTTACAGAAGAAGCTAGATATCG
TTGCATCAATCATGAAAGTGGCATTAGATTGTTGTGTTGAATCTCCGGCAACAAGGACAAACATGAAAGATGTTGTAGGGATGCTACAGA
AGATCAAGATTCAACTTCTTGCATGTTGA\(3')GCATGTTTTTGTATTTTTTGTTTCGAACCGATAGCTTTTTTTGTTTTGTTTTAGCA
CTTTGATTTTGTTTTCAGAAAAGACCCCGTTTCCTTTTAAAAAATAAAACCAAACTGATCCTCATGAAAATTTTGAAGTAGAATGATATT
TTTGTAAATTGTTAAGAGGAATTAACTATTTGAATAGAAATAAGCAAGTAATATAGTAAATGTTTTACATGGGGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan